y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g44950.2
FamilyCE16
Protein PropertiesLength: 363 Molecular Weight: 40154.1 Isoelectric Point: 5.95
ChromosomeChromosome/Scaffold: 06 Start: 47755752 End: 47758408
DescriptionGDSL-like Lipase/Acylhydrolase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE161383492.4e-22
  ALVWSLSDQLDMFREYKNKIMEIVGENRTATIISKGIYILCTGSNDITNTYVFRRVEYDIQAYTDLMASQATNFLQELYGLGARRIGVVGLPVLGCVPSQ
  RTIDGGISRACSDFENQAAVLFNSKLSSQMDALKKQFQEARLVYLDLYNPLLHLIQNPAKYGFEVIDKGCCGTGNLEVSLMCNHFVLHICSNTSNYIFWD
  SFHPTQAAYNVV
Full Sequence
Protein Sequence     Length: 363     Download
MNILFEKLLS QFPQVIPWSF AIVIISLHVS SVSLPNYESI PAVIVFGDSI VDTGNNNYIN    60
TIAKCNFLPY GRDFGGGNQP TGRFSNGLVP SDIIAAKFGV KELLPPYLDP KLQPQDLLTG    120
VSFASGANGY DPLTSKIALV WSLSDQLDMF REYKNKIMEI VGENRTATII SKGIYILCTG    180
SNDITNTYVF RRVEYDIQAY TDLMASQATN FLQELYGLGA RRIGVVGLPV LGCVPSQRTI    240
DGGISRACSD FENQAAVLFN SKLSSQMDAL KKQFQEARLV YLDLYNPLLH LIQNPAKYGF    300
EVIDKGCCGT GNLEVSLMCN HFVLHICSNT SNYIFWDSFH PTQAAYNVVC SLVLDHKIKD    360
FF*                                                                  420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01847Triacylglycerol_lipase_like9.0e-1142355326+
COG3240COG32405.0e-1244354322+
cd01846fatty_acyltransferase_like2.0e-2843356318+
PLN03156PLN031565.0e-10040361325+
cd01837SGNH_plant_lipase_like5.0e-13641355316+
Gene Ontology
GO TermDescription
GO:0006629lipid metabolic process
GO:0016788hydrolase activity, acting on ester bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19734.1013621366unknown [Glycine max]
EMBLCBI19909.1073622358unnamed protein product [Vitis vinifera]
RefSeqXP_002270878.102136216359PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279335.1083621356PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279381.1083621356PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3kvn_A0.0064334218301X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB3kvn_X0.0064334218301X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
Metabolic Pathways
Pathway NameReactionECProtein Name
triacylglycerol degradationTRIACYLGLYCEROL-LIPASE-RXNEC-3.1.1.3triacylglycerol lipase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX674893314413510
AW27803220142040
BE609778222803010
HO780479332353630
AW2776262171113270
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_051_00086.2Aquca_051_00088.1Aquca_019_00111.1Aquca_009_01045.1Aquca_020_00377.1
Aquca_075_00042.1Aquca_020_00377.2Aquca_028_00063.1Aquca_009_00480.1Aquca_003_00337.1
Aquca_028_00065.1Aquca_028_00064.1Aquca_026_00214.1Aquca_005_00130.3Aquca_005_00130.1
Aquca_051_00091.1Aquca_015_00423.1
Arabidopsis lyrata906695311764479089492123884658
899264316515862643316514494383
321717332543476497476744316517.110.326
Arabidopsis thalianaAT1G20132.1AT1G06990.1AT1G20130.2AT1G20130.1AT3G16370.1
AT2G40250.1AT5G03810.1AT5G03820.1AT5G42170.1AT4G26790.2
AT4G26790.1AT2G04570.1AT1G58430.1AT1G75900.1AT5G22810.1
AT1G75890.1AT1G75890.2AT1G75880.1AT1G75880.2AT1G20120.1
AT5G45950.1AT1G73610.1AT1G23500.1AT1G20135.1AT1G75920.4
AT1G75920.2AT1G75920.1AT1G75910.1AT1G75930.1
Brachypodium distachyonBradi2g22690.1Bradi4g27017.1Bradi1g50970.1Bradi1g50927.1Bradi1g12350.1
Bradi1g35340.1Bradi3g27407.1Bradi4g08597.1Bradi2g54060.1Bradi2g53830.1
Bradi3g00310.1
Brassica rapaBra004974Bra025794.569.881Bra025794.569.881Bra017022Bra012377
Bra040686Bra031550Bra027168Bra003736Bra013200
Bra026402Bra035295Bra020216Bra021725Bra015802
Bra016475Bra015804Bra012211Bra015803Bra003737
Bra022002Bra024605Bra025794.333.555Bra025794.333.555Bra012212
Carica papayaevm.model.supercontig_25.31evm.model.supercontig_47.41evm.model.supercontig_284.8evm.model.supercontig_132.39evm.model.supercontig_132.40
evm.model.supercontig_7.35evm.model.supercontig_6.291evm.model.supercontig_25.30evm.model.supercontig_26.293evm.model.supercontig_2.350
evm.model.supercontig_26.291
Capsella rubellaCarubv10011073mCarubv10012021mCarubv10028437mCarubv10017544mCarubv10014074m
Carubv10014077mCarubv10005151mCarubv10005150mCarubv10025193mCarubv10011033m
Carubv10020529mCarubv10003031mCarubv10012178mCarubv10021812mCarubv10020390m
Carubv10026665mCarubv10025096mCarubv10022025mCarubv10028290mCarubv10012369m
Carubv10021387m
Citrus clementinaCiclev10001578mCiclev10025938mCiclev10026212mCiclev10031929mCiclev10003119m
Ciclev10015771mCiclev10025900mCiclev10025957mCiclev10008798mCiclev10031968m
Ciclev10015728mCiclev10001561mCiclev10026202m
Citrus sinensisorange1.1g019497morange1.1g018227morange1.1g023164morange1.1g017687morange1.1g042648m
orange1.1g018664morange1.1g018844morange1.1g019347morange1.1g018245morange1.1g018232m
orange1.1g018209morange1.1g018195m
Cucumis sativusCucsa.139530.1Cucsa.021660.1Cucsa.139540.1Cucsa.185150.1Cucsa.385520.1
Cucsa.073330.1Cucsa.393990.1Cucsa.043810.1Cucsa.046680.1
Eucalyptus grandisEucgr.F03501.1Eucgr.F03090.1Eucgr.B03904.1Eucgr.A01085.1Eucgr.A01086.1
Eucgr.I02326.1Eucgr.F01671.1Eucgr.J02472.2Eucgr.D00574.1Eucgr.J02469.1
Eucgr.J02470.1Eucgr.J02472.1Eucgr.H00933.1Eucgr.H00934.1
Fragaria vescamrna21011.1-v1.0-hybridmrna14562.1-v1.0-hybridmrna26512.1-v1.0-hybridmrna14563.1-v1.0-hybridmrna25695.1-v1.0-hybrid
mrna28753.1-v1.0-hybridmrna14567.1-v1.0-hybridmrna08561.1-v1.0-hybridmrna08560.1-v1.0-hybridmrna14406.1-v1.0-hybrid
Glycine maxGlyma11g19600.2Glyma02g39800.2Glyma02g39820.1Glyma13g30680.3Glyma06g02520.1
Glyma04g02480.1Glyma07g01680.1Glyma08g21340.1Glyma13g42960.1Glyma11g08420.3
Glyma11g08420.2Glyma06g44970.1Glyma02g05150.1Glyma16g23290.1Glyma11g19600.3
Glyma11g19600.1Glyma17g37920.1Glyma02g05210.1Glyma14g40200.1Glyma17g37930.1
Glyma15g08600.1Glyma16g23260.2Glyma17g37910.1Glyma02g43180.1Glyma14g40220.1
Gossypium raimondiiGorai.010G002200.1Gorai.009G138200.2Gorai.009G138200.7Gorai.009G138200.1Gorai.009G138200.9
Gorai.009G138200.3Gorai.009G138200.8Gorai.001G118700.1Gorai.011G070000.2Gorai.001G211300.1
Gorai.011G070000.3Gorai.003G108700.2Gorai.003G108700.1Gorai.010G002300.1Gorai.011G070000.1
Gorai.009G138200.5Gorai.009G138200.6Gorai.009G192700.1Gorai.001G217800.1Gorai.007G169400.1
Gorai.013G157800.1Gorai.009G165200.2Gorai.009G165200.1Gorai.012G079700.1
Linum usitatissimumLus10034541Lus10026406Lus10028423Lus10008639Lus10035585
Lus10040791Lus10006856Lus10037598Lus10041877Lus10006855
Lus10013572Lus10003717Lus10028424Lus10029958Lus10013956
Lus10034540Lus10005279Lus10034542Lus10003720Lus10028425
Lus10026074
Malus domesticaMDP0000310487MDP0000202137MDP0000137339MDP0000928830MDP0000168305
MDP0000132214MDP0000546054MDP0000150756MDP0000146939MDP0000317158
MDP0000250901MDP0000175342MDP0000270993MDP0000261876MDP0000291231
MDP0000151291MDP0000151161MDP0000174332MDP0000918407MDP0000255794
MDP0000158653MDP0000949017MDP0000617020MDP0000146006MDP0000120560
Manihot esculentacassava4.1_024022mcassava4.1_010784mcassava4.1_010676mcassava4.1_010329mcassava4.1_021526m
cassava4.1_009843mcassava4.1_027640mcassava4.1_028090mcassava4.1_010562mcassava4.1_027779m
Medicago truncatulaMedtr5g074270.1Medtr5g083040.1Medtr1g025700.1Medtr8g014910.1Medtr2g100620.1
Medtr5g022630.1Medtr5g084750.1Medtr5g084790.1Medtr5g022640.1Medtr1g025780.1
Medtr8g075220.1Medtr8g075200.1Medtr8g075230.1Medtr1g025720.1Medtr3g114090.1
Medtr1g025760.1Medtr1g025680.1Medtr3g114120.1
Mimulus guttatusmgv1a009146mmgv1a009432mmgv1a025165mmgv1a023444mmgv1a009257m
mgv1a008997mmgv1a026832mmgv1a008769mmgv1a026265mmgv1a022118m
mgv1a009073mmgv1a008691mmgv11b017326m
Oryza sativaLOC_Os09g04710.2LOC_Os09g07290.1LOC_Os06g05550.1LOC_Os03g47940.1LOC_Os06g05630.1
LOC_Os09g04624.1LOC_Os09g04710.1LOC_Os02g09610.1LOC_Os06g43044.1LOC_Os01g61570.1
LOC_Os05g39220.1LOC_Os01g61200.1LOC_Os02g01140.1LOC_Os10g05088.1
Panicum virgatumPavirv00008337mPavirv00000261mPavirv00038024mPavirv00061519mPavirv00069761m
Pavirv00025663mPavirv00009013mPavirv00054177mPavirv00056235mPavirv00067881m
Pavirv00015386mPavirv00009930mPavirv00028004mPavirv00022742mPavirv00041979m
Pavirv00068226mPavirv00065272mPavirv00024442mPavirv00018906mPavirv00059280m
Pavirv00002050mPavirv00000501mPavirv00053952mPavirv00027728m
Physcomitrella patensPp1s35_26V6.1Pp1s199_62V6.1Pp1s52_15V6.1Pp1s306_55V6.1
Phaseolus vulgarisPhvul.003G013500.1Phvul.009G018300.1Phvul.010G143600.1Phvul.005G164800.1Phvul.011G118200.1
Phvul.002G106300.1Phvul.008G215600.1Phvul.008G215500.1Phvul.011G088700.1Phvul.003G265600.1
Phvul.001G004400.1Phvul.009G018100.1Phvul.003G265500.1Phvul.006G179500.1Phvul.001G004500.1
Picea abiesMA_127685g0010MA_103942g0010MA_166543g0010MA_92286g0010MA_9037505g0010
MA_95274g0010MA_58098g0010MA_27394g0010MA_95656g0010MA_10425922g0010
MA_77591g0010MA_429323g0010MA_8087g0010MA_201164g0010MA_10224291g0010
MA_10223491g0010MA_345345g0010
Populus trichocarpaPotri.008G076600.1Potri.009G151000.1Potri.001G191400.1Potri.005G205100.1Potri.005G242800.2
Potri.005G242800.1Potri.013G153000.1Potri.002G018800.1Potri.006G144400.1Potri.004G051900.1
Prunus persicappa026294mppa007967mppa007650mppa007953mppa007979m
ppa020405mppa008001mppa009528mppa023913mppa009531m
ppa017759mppa007642mppa009721m
Ricinus communis30190.m01129729991.m00062430146.m00347529620.m00055029640.m000407
30170.m014261.465.69830170.m014261.465.69829900.m00156329814.m00074530170.m014261.105.341
30170.m014261.105.341
Setaria italicaSi015739mSi036350mSi006758mSi006760mSi030253m
Si017624mSi030338mSi006691mSi022485mSi031143m
Si032305mSi002061mSi017542mSi006463mSi025090m
Selaginella moellendorffii8992142699743876879568
Sorghum bicolorSb01g026440.1Sb01g011850.1Sb10g003340.1Sb10g003420.1Sb10g024910.1
Sb08g021590.1Sb01g027030.1Sb02g012990.1Sb06g019980.1Sb02g031310.1
Sb01g021130.1Sb01g000430.1Sb03g038590.1Sb04g000310.1Sb09g023010.1
Sb02g002860.1
Thellungiella halophilaThhalv10008023mThhalv10007871mThhalv10008013mThhalv10007885mThhalv10008086m
Thhalv10010500mThhalv10021008mThhalv10025598mThhalv10018754mThhalv10002592m
Thhalv10007776mThhalv10018728mThhalv10000940mThhalv10005274mThhalv10019814m
Thhalv10018807mThhalv10019865m
Vitis viniferaGSVIVT01016949001GSVIVT01009961001GSVIVT01009962001GSVIVT01009963001GSVIVT01009959001
GSVIVT01009960001GSVIVT01009957001GSVIVT01009958001GSVIVT01016950001GSVIVT01021149001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)