y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma06g47761.7
FamilyGH5
Protein PropertiesLength: 310 Molecular Weight: 35197.4 Isoelectric Point: 5.1707
ChromosomeChromosome/Scaffold: 06 Start: 50162474 End: 50170874
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH5282910
  MRDHWNTYITEDDFRFMSANGLNAVRIPVGWWIAKDPNPPKPFVGGSLAALDNAFIWAQNHGMNVIIDLHAAEGSQNGNDHSGARDGYTEWGDSYIPNTV
  QVIDFLAERYGNKPNLGGIELMNEPFGVNLESLKKYYKEAYDAVRKHNSSAYVIMSNPLDADSKVLLSFVKDFDRVVIDVHYYNLFWNGFDSMTVQENID
  FIRNERVSNLGGVSSTNALSFVGEWTGEWAVKGATKEDYQRYAQAQLGVYSRATFGWAYWSYKC
Full Sequence
Protein Sequence     Length: 310     Download
MNIVPDTTLQ GEYQLTNGYG PDRAPQVMRD HWNTYITEDD FRFMSANGLN AVRIPVGWWI    60
AKDPNPPKPF VGGSLAALDN AFIWAQNHGM NVIIDLHAAE GSQNGNDHSG ARDGYTEWGD    120
SYIPNTVQVI DFLAERYGNK PNLGGIELMN EPFGVNLESL KKYYKEAYDA VRKHNSSAYV    180
IMSNPLDADS KVLLSFVKDF DRVVIDVHYY NLFWNGFDSM TVQENIDFIR NERVSNLGGV    240
SSTNALSFVG EWTGEWAVKG ATKEDYQRYA QAQLGVYSRA TFGWAYWSYK CRFNEWSMKW    300
MIQNGRIKL*                                                           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00150Cellulase2.0e-2431289269+
COG2730BglC1.0e-2930306319+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankADD09589.101309195504unknown [Trifolium repens]
EMBLCAN74231.101309303607hypothetical protein [Vitis vinifera]
EMBLCBI18831.101309195505unnamed protein product [Vitis vinifera]
EMBLCBI33033.101309195505unnamed protein product [Vitis vinifera]
RefSeqXP_002309987.101309145455predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1eqp_A3e-361230545376A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans
PDB2pc8_A4e-361230551382A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
PDB2pbo_A4e-361230551382A Chain A, E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A
PDB2pb1_A5e-361230551382A Chain A, Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Unhydrolysed And Covalently Linked 2,4-dinitrophenyl-2-deoxy-2- Fluoro-b-d-glucopyranoside At 1.9 A
PDB1eqc_A5e-361230545376A Chain A, Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Unhydrolysed And Covalently Linked 2,4-dinitrophenyl-2-deoxy-2- Fluoro-b-d-glucopyranoside At 1.9 A
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CF80782323592430
DC89929931313090
DC89890531313090
CX666375285293090
DW51514528082830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.3Glyma18g01781.1Glyma06g47761.6
Glyma06g47761.1Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4
Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1Glyma08g14676.1
Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)