y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g05980.1
FamilyAA1
Protein PropertiesLength: 573 Molecular Weight: 64096.5 Isoelectric Point: 8.7141
ChromosomeChromosome/Scaffold: 07 Start: 4693764 End: 4698231
Descriptionlaccase 6
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1345590
  TRFYDFKVQTKRVTKLCNSKDIVTINGMFPGPVVYAQEDDRIIVKVTNMTPFNVTIHWHGVRQRLSCWYDGASLITQCPIQSGQSFTYNFTVVQQKGTFF
  WHAHISWLRGTVYGAMIVYPKTGVPYPFNFPYQEHIIILGEYWLQDLQQIENATIASGGPPPIADAYTINGHPGPNYNCSTNDVYQINVIPGKIYLLRLI
  NAGLNTENFFSIAYHNLTIVEADAEYTKPFTTDTVMIGPGQTLNVLLSADQPIGKYSMAITPYKSGRFVKYQNISAIAYFNYIGTSSDSLPLPAKLPKLD
  DKLAVKTVMDGLRSLNQVNVFKEIDKNLFVTIGLNVQKCHSKKPKQNCQFMHNGVLAASMNNVSFVNPNISILGAYYKKIKGSYTEDFPDTPPKFYDFVN
  GAPNNISYDTQSLNGTRTKVLKYGSRVQLIMQDTGIVNTENHPMHFHGYSFYVVGYGTGNYNPRTAKFNLVDPPYMNTIGVPAGGWAAIRFVADNPGVWY
  MHCHIDIHMQWGLGMVFIVNNGKGEL
Full Sequence
Protein Sequence     Length: 573     Download
MANLITLFSL WLSMMSTIYS VKLIANGSTK GESTRFYDFK VQTKRVTKLC NSKDIVTING    60
MFPGPVVYAQ EDDRIIVKVT NMTPFNVTIH WHGVRQRLSC WYDGASLITQ CPIQSGQSFT    120
YNFTVVQQKG TFFWHAHISW LRGTVYGAMI VYPKTGVPYP FNFPYQEHII ILGEYWLQDL    180
QQIENATIAS GGPPPIADAY TINGHPGPNY NCSTNDVYQI NVIPGKIYLL RLINAGLNTE    240
NFFSIAYHNL TIVEADAEYT KPFTTDTVMI GPGQTLNVLL SADQPIGKYS MAITPYKSGR    300
FVKYQNISAI AYFNYIGTSS DSLPLPAKLP KLDDKLAVKT VMDGLRSLNQ VNVFKEIDKN    360
LFVTIGLNVQ KCHSKKPKQN CQFMHNGVLA ASMNNVSFVN PNISILGAYY KKIKGSYTED    420
FPDTPPKFYD FVNGAPNNIS YDTQSLNGTR TKVLKYGSRV QLIMQDTGIV NTENHPMHFH    480
GYSFYVVGYG TGNYNPRTAK FNLVDPPYMN TIGVPAGGWA AIRFVADNPG VWYMHCHIDI    540
HMQWGLGMVF IVNNGKGELE SLPHPPPDLP QC*                                 600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam07732Cu-oxidase_39.0e-4740156119+
PLN02191PLN021911.0e-7029551556+
TIGR03388ascorbase2.0e-8934550563+
TIGR03389laccase033572546+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN75876.1015721571hypothetical protein [Vitis vinifera]
RefSeqNP_182180.103157228569LAC6 (laccase 6); laccase [Arabidopsis thaliana]
RefSeqXP_002264410.1015721571PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002320207.10465723529predicted protein [Populus trichocarpa]
RefSeqXP_002523314.103057230572laccase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0355504521A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB1asq_A0355504521A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB1asp_B0355504521A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB1asp_A0355504521A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
PDB1aso_B0355504521A Chain A, Crystal Structure Of Chondroitin Polymerase From Escherichia Coli Strain K4 (K4cp) Complexed With Udp-Glcua And Udp
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797675504785730
DW134242271303000
EL350827267513170
DW157222255302840
DY962939255302840
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00115.1Aquca_003_00113.1Aquca_003_00114.1Aquca_003_00112.1Aquca_037_00220.1
Aquca_009_00938.1Aquca_004_00451.1Aquca_003_00108.1Aquca_030_00210.1Aquca_003_00114.2
Aquca_001_00081.1Aquca_009_00738.1Aquca_006_00087.1Aquca_004_00287.1Aquca_096_00048.1
Aquca_009_00808.1Aquca_010_00519.1Aquca_004_00288.1Aquca_009_00806.1Aquca_032_00101.1
Aquca_006_00057.1
Arabidopsis lyrata496140487334901874482815903327
871194487097481932860582497195
496014325328889226
Arabidopsis thalianaAT5G60020.1AT5G05390.1AT2G38080.1AT2G40370.1AT2G29130.1
AT2G46570.1AT2G30210.1AT5G03260.1AT5G01190.1AT5G58910.1
AT5G07130.1AT1G18140.1
Brachypodium distachyonBradi2g54680.1Bradi2g54690.1Bradi1g24880.1Bradi2g23350.1Bradi1g24910.1
Bradi1g74320.1Bradi1g66720.1Bradi2g54740.1Bradi2g23370.1Bradi4g44810.1
Bradi2g53800.1Bradi1g65100.1
Brassica rapaBra006683Bra020269Bra002515Bra017139Bra039274
Bra009540Bra028844Bra018408Bra002609Bra028891
Bra034852Bra028760Bra009111Bra017010Bra004966
Bra016568Bra021620Bra018328Bra009290
Carica papayaevm.model.supercontig_336.3evm.model.supercontig_96.55evm.model.supercontig_139.14evm.model.supercontig_26.306evm.model.supercontig_85.78
evm.model.supercontig_84.5evm.model.supercontig_19.119evm.model.supercontig_81.112evm.model.supercontig_56.120evm.model.supercontig_85.79
evm.model.supercontig_56.82
Capsella rubellaCarubv10026150mCarubv10000596mCarubv10022868mCarubv10022927mCarubv10025638m
Carubv10022891mCarubv10000520mCarubv10025575mCarubv10028274mCarubv10000605m
Carubv10011512mCarubv10016290mCarubv10002622mCarubv10008683m
Citrus clementinaCiclev10030166mCiclev10011362mCiclev10011358mCiclev10028090mCiclev10011363m
Ciclev10018047mCiclev10023643mCiclev10011400mCiclev10031070mCiclev10011375m
Ciclev10013446mCiclev10011384mCiclev10031134mCiclev10025287mCiclev10028117m
Ciclev10011377mCiclev10030322mCiclev10003240mCiclev10028036m
Citrus sinensisorange1.1g047497morange1.1g008085morange1.1g008109morange1.1g008090morange1.1g039250m
orange1.1g009358morange1.1g008351morange1.1g008066morange1.1g008422morange1.1g036540m
orange1.1g008799morange1.1g008484morange1.1g009854morange1.1g008366morange1.1g040938m
orange1.1g039963morange1.1g009392morange1.1g038598morange1.1g013075morange1.1g017112m
orange1.1g013875m
Cucumis sativusCucsa.207260.1Cucsa.175530.1Cucsa.175560.1Cucsa.176130.1Cucsa.067060.1
Cucsa.106570.1Cucsa.146870.1Cucsa.124400.1Cucsa.066920.1Cucsa.121840.1
Cucsa.136790.1Cucsa.151810.1Cucsa.136460.1Cucsa.136460.2
Eucalyptus grandisEucgr.K03111.1Eucgr.J00532.1Eucgr.E00040.1Eucgr.B02428.1Eucgr.A01282.1
Eucgr.L00355.1Eucgr.L00359.1Eucgr.G03098.1Eucgr.H03315.1Eucgr.L01734.1
Eucgr.B02794.1Eucgr.J00166.1Eucgr.B02796.1Eucgr.B02799.1Eucgr.B02798.1
Eucgr.B02797.1Eucgr.K02996.1Eucgr.B02795.1Eucgr.K03008.1Eucgr.B02316.1
Eucgr.B00870.1Eucgr.A01282.2Eucgr.G03028.1Eucgr.B00869.1Eucgr.J01941.1
Eucgr.J01857.1Eucgr.B04003.1Eucgr.B02753.1Eucgr.B02751.1Eucgr.K03009.1
Eucgr.B02752.1Eucgr.B02750.1Eucgr.B02438.1
Fragaria vescamrna14033.1-v1.0-hybrid.331.867mrna18442.1-v1.0-hybridmrna21281.1-v1.0-hybridmrna07983.1-v1.0-hybridmrna14031.1-v1.0-hybrid
mrna14746.1-v1.0-hybridmrna25238.1-v1.0-hybridmrna20911.1-v1.0-hybridmrna20428.1-v1.0-hybridmrna18757.1-v1.0-hybrid
mrna07465.1-v1.0-hybridmrna07472.1-v1.0-hybridmrna18444.1-v1.0-hybridmrna18760.1-v1.0-hybridmrna09404.1-v1.0-hybrid
mrna18812.1-v1.0-hybridmrna28184.1-v1.0-hybridmrna18694.1-v1.0-hybrid
Glycine maxGlyma08g47400.1Glyma18g38700.1Glyma18g38690.1Glyma08g47380.1Glyma08g47380.2
Glyma18g38710.1Glyma08g46820.1Glyma12g06480.1Glyma18g40070.1Glyma07g16080.1
Glyma11g14600.1Glyma14g06070.1Glyma02g42940.1Glyma03g14450.1Glyma18g02690.1
Glyma18g40050.1Glyma11g07430.1Glyma07g16060.1Glyma14g37040.1Glyma01g37920.1
Glyma01g37930.1Glyma11g35700.1Glyma07g05970.1Glyma01g27710.1Glyma11g07420.2
Glyma02g38990.1Glyma18g07240.1Glyma12g14230.1Glyma18g38661.1Glyma11g29620.1
Glyma07g17140.1Glyma18g06450.1Glyma14g37810.1Glyma14g06760.1Glyma02g39750.1
Glyma02g38990.2Glyma18g42520.1
Gossypium raimondiiGorai.013G021400.1Gorai.013G025500.1Gorai.009G103200.1Gorai.002G257100.1Gorai.013G263200.1
Gorai.006G171500.1Gorai.003G129800.1Gorai.007G376600.1Gorai.003G129700.1Gorai.007G376800.1
Gorai.012G110000.1Gorai.007G110500.1Gorai.008G126500.1Gorai.003G096600.1Gorai.007G378200.1
Gorai.010G194300.1Gorai.011G101300.1Gorai.010G194600.1Gorai.011G290000.1Gorai.012G111900.1
Gorai.002G148200.1Gorai.009G093800.1Gorai.013G036200.1Gorai.012G109700.1Gorai.003G124600.1
Gorai.002G261500.1Gorai.004G234200.1Gorai.011G279600.1Gorai.012G109500.1Gorai.009G321900.1
Gorai.003G150200.1Gorai.012G109900.1Gorai.003G129500.1Gorai.007G205400.1Gorai.003G096600.2
Gorai.013G027600.1
Linum usitatissimumLus10034439Lus10019122Lus10034614Lus10024378Lus10030235
Lus10026512Lus10005976Lus10023189Lus10010850Lus10002227
Lus10035546Lus10027747Lus10017427Lus10032894Lus10035517
Lus10027782Lus10017175Lus10018208Lus10040697Lus10028263
Lus10040957Lus10009841Lus10007531Lus10007532Lus10017426
Lus10041481Lus10034289Lus10009645Lus10040936Lus10009827
Lus10026400
Malus domesticaMDP0000237964.34.576MDP0000237964.34.576MDP0000175212MDP0000299358MDP0000280305
MDP0000307655MDP0000252970MDP0000149146MDP0000240772
Manihot esculentacassava4.1_004370mcassava4.1_004430mcassava4.1_021113mcassava4.1_023475mcassava4.1_004438m
cassava4.1_025343mcassava4.1_004790mcassava4.1_004450mcassava4.1_004799mcassava4.1_004785m
cassava4.1_004439mcassava4.1_031010mcassava4.1_004761mcassava4.1_004756mcassava4.1_005501m
cassava4.1_004807mcassava4.1_032997mcassava4.1_004601mcassava4.1_033814m
Medicago truncatulaMedtr7g060460.1AC225529_15.1Medtr7g058690.1Medtr4g064530.1Medtr7g058750.1
Medtr5g083360.1Medtr5g069680.1Medtr5g020620.1Medtr4g015120.1Medtr5g020600.1
Medtr3g071890.1Medtr5g081810.1Medtr5g073210.1
Mimulus guttatusmgv1a003840mmgv1a003496mmgv1a003538mmgv1a026682mmgv1a003472m
mgv1a003793mmgv1a003791mmgv1a003895mmgv1a003805mmgv1a025875m
mgv1a020620mmgv1a003880mmgv1a022676m
Oryza sativaLOC_Os01g62490.1LOC_Os01g62480.1LOC_Os05g38420.1LOC_Os03g16610.1LOC_Os05g38410.1
LOC_Os11g48060.1LOC_Os01g44330.1LOC_Os01g61160.1LOC_Os11g01730.1LOC_Os12g01730.1
LOC_Os01g62600.1LOC_Os05g38390.1
Panicum virgatumPavirv00038112mPavirv00009758mPavirv00060825mPavirv00006286mPavirv00015675m
Pavirv00021368mPavirv00052830mPavirv00018740mPavirv00012374mPavirv00048747m
Pavirv00058463m
Phaseolus vulgarisPhvul.008G100400.1Phvul.011G062600.1Phvul.008G119200.1Phvul.008G119000.1Phvul.010G073800.1
Phvul.005G145800.1Phvul.008G220300.1Phvul.001G246700.1Phvul.002G031600.1Phvul.002G031700.1
Phvul.006G065800.1Phvul.008G263100.1Phvul.010G115300.1Phvul.008G100500.1Phvul.008G107100.1
Phvul.008G226700.1Phvul.006G074000.1Phvul.008G252800.1Phvul.008G112200.1
Picea abiesMA_136989g0010MA_33057g0010MA_118833g0010MA_10434864g0010MA_19643g0010
MA_76578g0010MA_75861g0010MA_57140g0010MA_67291g0010MA_10434090g0010
MA_192698g0010MA_192464g0010MA_28768g0010MA_57140g0020MA_811078g0010
MA_132857g0010MA_10428927g0020MA_170004g0010MA_122769g0010MA_14717g0010
MA_185257g0010MA_10432715g0010MA_10428927g0010MA_10427033g0010MA_205016g0010
MA_10432961g0010MA_897132g0010MA_8866650g0010MA_66348g0010MA_33288g0010
Populus trichocarpaPotri.001G054600.1Potri.001G341600.1Potri.006G087500.1Potri.001G401300.1Potri.009G034500.1
Potri.001G401100.1Potri.009G156800.1Potri.011G120300.1Potri.011G120200.1Potri.009G156600.1
Potri.001G184300.1Potri.006G087100.1Potri.014G100600.1Potri.016G112000.1Potri.008G073700.1
Potri.006G097100.1Potri.010G183500.1Potri.010G183600.1Potri.010G183500.2Potri.006G096900.1
Potri.008G073800.1Potri.006G097000.1Potri.006G094100.1Potri.008G073800.4Potri.008G073800.2
Potri.007G023300.1Potri.016G112100.1Potri.009G042500.1Potri.004G156400.1Potri.008G064000.1
Potri.010G193100.1Potri.009G102700.1Potri.004G156400.2Potri.015G040400.1Potri.016G106300.1
Potri.001G248700.1Potri.015G040600.1Potri.008G073800.3Potri.012G048900.1Potri.016G107500.1
Potri.016G106000.1Potri.013G152700.1Potri.016G107900.1Potri.016G106100.1Potri.016G112000.2
Potri.019G121700.1Potri.008G073800.5Potri.019G124300.1Potri.010G183600.2Potri.010G193100.2
Potri.015G040700.1Potri.013G152700.2Potri.019G121700.3Potri.019G121700.2Potri.015G040800.1
Prunus persicappa017421mppa003308mppa003296mppa003319mppa022440m
ppa003349mppa003714mppa015544mppa003590mppa021338m
ppa003577mppa003572mppa027203mppa003646mppa019880m
ppa003408mppa003587m
Ricinus communis30004.m00042730130.m00026829568.m00029029568.m00029330004.m000428
29742.m00138629729.m00229529729.m00229427798.m00061029568.m000289
29751.m00190530131.m00704830078.m00232727847.m00012629751.m001786
30113.m00143229610.m000409
Setaria italicaSi021577mSi000806mSi034916mSi000854mSi026172m
Si021592mSi000813mSi004574mSi000492mSi027545m
Si001625m
Selaginella moellendorffii105894802141653657800295740
40407578404231207230356438115
404333
Sorghum bicolorSb03g039530.1Sb09g022510.1Sb03g039520.1Sb01g039690.1Sb09g022460.1
Sb03g039570.1Sb03g038550.1Sb01g038130.1Sb05g000680.1
Thellungiella halophilaThhalv10013109mThhalv10015589mThhalv10016434mThhalv10016460mThhalv10016439m
Thhalv10001377mThhalv10016445mThhalv10015593mThhalv10013135mThhalv10013285m
Thhalv10016451mThhalv10016450mThhalv10007176mThhalv10013732m
Vitis viniferaGSVIVT01025077001GSVIVT01025046001GSVIVT01034137001GSVIVT01034138001GSVIVT01034146001
GSVIVT01034139001GSVIVT01027179001GSVIVT01032744001GSVIVT01016513001GSVIVT01024634001
GSVIVT01034003001GSVIVT01025694001GSVIVT01018939001GSVIVT01033501001GSVIVT01024795001
GSVIVT01016372001GSVIVT01034040001GSVIVT01016512001.24.499GSVIVT01016512001.24.499GSVIVT01016490001.35.454
GSVIVT01016490001.35.454GSVIVT01008406001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)