y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g06210.1
FamilyGT4
Protein PropertiesLength: 460 Molecular Weight: 51811 Isoelectric Point: 8.4573
ChromosomeChromosome/Scaffold: 07 Start: 4923256 End: 4928500
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42634221.8e-24
  EIPVLISVAQFRPEKAHTLQLEAFSAAIKRLDPSLPKPKFQIVGSCRNKSDEDRLQMLKEKAIELNVNEHMEFHKNVTYRDLVGLLGGAVAGIHSMTDEH
  FGISVVEYMAAGAIPIAHNSAGPKMDIVLDEEGQQTGFLACSVEEYADAMVRIVSMPEME
Full Sequence
Protein Sequence     Length: 460     Download
MLTMIITALI TAILAGLCIG PINGRRRRKR AVAFFHPYTN DGGGGERVLW CAVRGIQEES    60
PDLDCYVYTG DHDATPQSLM ARALDRFGVA LLSPPKVVHL YKRKWIEETT YPHFTMIGQS    120
LGSVYLAWEA LCKFTPIYYF DTSGYAFTYP LARLFGCKVI CYTHYPTISS DMLARVRQRS    180
FMYNNDALIT KSVWLSRCKI VYYTVFSCLY GFVGSCAHLA MVNSSWTKSH IENLWRFPDR    240
IKRVYPPCDT SGLQVLPLER SAEIPVLISV AQFRPEKAHT LQLEAFSAAI KRLDPSLPKP    300
KFQIVGSCRN KSDEDRLQML KEKAIELNVN EHMEFHKNVT YRDLVGLLGG AVAGIHSMTD    360
EHFGISVVEY MAAGAIPIAH NSAGPKMDIV LDEEGQQTGF LACSVEEYAD AMVRIVSMPE    420
MERLKMAAAA RRRAGRFSEQ RFYDDFKAAV HPILCHISR*                          480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03801GT1_YqgM_like2.0e-18217426219+
pfam00534Glycos_transf_11.0e-20265423161+
cd03805GT1_ALG2_like6.0e-2232442434+
PLN02949PLN02949022459438+
cd03806GT1_ALG11_like030445419+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABA99697.103145431454glycosyl transferase, group 1 family protein, expressed [Oryza sativa (japonica cultivar-group)]
RefSeqNP_181548.202345427458glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002271550.102345828463PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318120.102245929466predicted protein [Populus trichocarpa]
RefSeqXP_002528312.102245928465glycosyl transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A0.000000326843727177A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5464EC-2.4.1.131GDP-Man:Man3GlcNAc2-PP-Dol α-1,2-mannosyltransferase
Transmembrane Domains
StartEnd
524
200222
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY263372375233860
DY269908308233300
DY299378308233300
DY295841404244250
DY284292321233420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_045_00152.10Aquca_045_00152.3Aquca_045_00152.4Aquca_045_00152.7Aquca_045_00152.8
Aquca_045_00152.2Aquca_045_00152.1Aquca_013_00559.1Aquca_013_00559.3
Arabidopsis lyrata497266
Arabidopsis thalianaAT2G40190.1
Brachypodium distachyonBradi4g03380.2
Brassica rapaBra004979Bra017025
Capsella rubellaCarubv10023116m
Chlamydomonas reinhardtiig1252.t1
Citrus clementinaCiclev10031450m
Citrus sinensisorange1.1g012436m
Cucumis sativusCucsa.368390.1
Eucalyptus grandisEucgr.G03076.1
Glycine maxGlyma16g02840.1
Gossypium raimondiiGorai.013G017200.1
Linum usitatissimumLus10028977
Manihot esculentacassava4.1_010258m
Medicago truncatulaAC235758_14.1AC233112_1009.1
Mimulus guttatusmgv1a005920m
Oryza sativaLOC_Os12g39340.1
Panicum virgatumPavirv00014744mPavirv00065689m
Physcomitrella patensPp1s269_93V6.1
Phaseolus vulgarisPhvul.010G113600.1
Populus trichocarpaPotri.012G095500.1
Prunus persicappa005444m
Ricinus communis29814.m000733
Setaria italicaSi021990m
Selaginella moellendorffii80274
Sorghum bicolorSb08g019540.1
Thellungiella halophilaThhalv10016619m
Vitis viniferaGSVIVT01032791001
Volvox carteriVocar20008969m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny