y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g08060.2
FamilyGH5
Protein PropertiesLength: 472 Molecular Weight: 52868.3 Isoelectric Point: 7.4512
ChromosomeChromosome/Scaffold: 07 Start: 6704892 End: 6707173
DescriptionCellulase (glycosyl hydrolase family 5) protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH5403302.4e-31
  EATGQRAKLVCGNWAGHLKPMIPEGLDRRPLKDIVSELVEHKFSCVRLTYAIYMWTRYGNGNVNATFDSLDAPEVVEGIAKNNPSVLSMTHVEVFDAVVH
  ELGAQNVKVLLDNHEWVHGLTLAAEHFSGNHAVVAMSLRNELHGPRQNLRDWYRYMNQGALAIHKANPNVLVVISGLNYDTELQFLKSKPLKIGLGKKMV
  FETHLYSWSGIGTLKLKQIWTKQPLNRICANSIKGIDHRAGFLTAGKNASPLIFTEFGFDETGSSVEDNRFLTCLQTYLVGRDLDWGLGAF
Full Sequence
Protein Sequence     Length: 472     Download
MLLGKPSQLL FLLLLVFIFE IASHSNAYPL STHKRWIIDE ATGQRAKLVC GNWAGHLKPM    60
IPEGLDRRPL KDIVSELVEH KFSCVRLTYA IYMWTRYGNG NVNATFDSLD APEVVEGIAK    120
NNPSVLSMTH VEVFDAVVHE LGAQNVKVLL DNHEWVHGLT LAAEHFSGNH AVVAMSLRNE    180
LHGPRQNLRD WYRYMNQGAL AIHKANPNVL VVISGLNYDT ELQFLKSKPL KIGLGKKMVF    240
ETHLYSWSGI GTLKLKQIWT KQPLNRICAN SIKGIDHRAG FLTAGKNASP LIFTEFGFDE    300
TGSSVEDNRF LTCLQTYLVG RDLDWGLGAF QGSYYTWHHL SNPNFTDKFQ LLQRKNQEPS    360
SKVPSLYILY HPLSGQCAQV NGKNELEVGS SAERLSVVVS DECQSKNSSW ETVSLSKLHL    420
ATTDQHEKQL CLQKDSNSSS IVTSKCICIK DDSQCLDDPQ SQWFQLVATN V*            480
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD32354.10104706534Glycoside hydrolase, family 5; Ricin B-related lectin [Medicago truncatula]
RefSeqXP_002272386.1084714531PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002272422.10847187614PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002509877.1084713546hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis]
RefSeqXP_002509879.103347130535hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ece_B0.000000000002323578337A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB1ece_A0.000000000002323578337A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB1vrx_B0.000000000005323578337A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1vrx_A0.000000000005323578337A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO3381112702494720
GO025078172211670
GO025078441702130
EL513843253242490
DY937433297162850
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00429.2Aquca_011_00429.1Aquca_001_00170.1Aquca_001_00171.1Aquca_011_00425.1
Aquca_011_00424.1Aquca_011_00428.1Aquca_011_00423.1Aquca_001_00172.1
Arabidopsis lyrata471466322756864961488616326109
882032
Arabidopsis thalianaAT5G17500.1AT1G13130.1AT3G26140.1AT3G26130.1AT5G16700.1
Brachypodium distachyonBradi5g13560.1Bradi5g13550.1
Brassica rapaBra025186Bra019811Bra025187Bra026437Bra026436
Bra023580Bra013972Bra008603Bra026925
Carica papayaevm.model.supercontig_33.65evm.model.supercontig_33.69evm.model.supercontig_33.67
Capsella rubellaCarubv10008758mCarubv10019167mCarubv10016955mCarubv10002868m
Citrus clementinaCiclev10031098mCiclev10023534m
Citrus sinensisorange1.1g013842morange1.1g008330morange1.1g015062morange1.1g039248m
Cucumis sativusCucsa.286780.1Cucsa.275330.1Cucsa.115540.1Cucsa.108400.1Cucsa.115550.1
Cucsa.365480.1Cucsa.303610.1Cucsa.303620.1Cucsa.129000.1Cucsa.275320.1
Eucalyptus grandisEucgr.B03243.1Eucgr.H02462.1Eucgr.H02464.1Eucgr.H02457.1Eucgr.H02458.1
Eucgr.D01800.1
Glycine maxGlyma05g30691.1Glyma11g18350.1Glyma05g30681.1Glyma08g13880.2Glyma18g01630.1
Glyma08g13891.1Glyma08g06511.1
Gossypium raimondiiGorai.002G188600.1Gorai.012G173600.1
Linum usitatissimumLus10011404Lus10006462Lus10011403Lus10006461Lus10024686
Lus10032312
Malus domesticaMDP0000753366MDP0000729817
Manihot esculentacassava4.1_004696mcassava4.1_031675mcassava4.1_025125m
Medicago truncatulaMedtr4g091610.1Medtr7g012780.1Medtr7g012530.1Medtr3g086450.1Medtr7g012540.1
Medtr7g012840.1Medtr5g088330.1
Mimulus guttatusmgv1a004205mmgv1a018920mmgv1a020519mmgv1a004243mmgv1a004297m
Oryza sativaLOC_Os04g40510.2LOC_Os04g40510.1LOC_Os02g38260.1LOC_Os04g40500.1LOC_Os04g40490.1
Panicum virgatumPavirv00025159mPavirv00029795mPavirv00010845mPavirv00023661mPavirv00002791m
Pavirv00002936m
Physcomitrella patensPp1s94_121V6.1Pp1s114_176V6.1Pp1s298_71V6.1
Phaseolus vulgarisPhvul.002G258500.1Phvul.011G098000.1Phvul.002G258400.1Phvul.002G220300.1Phvul.010G095100.1
Picea abiesMA_318998g0010MA_463555g0010MA_8507901g0010MA_10432675g0010
Populus trichocarpaPotri.008G183400.2Potri.008G183400.1Potri.010G049700.1Potri.010G049800.1Potri.008G183400.3
Potri.001G097900.1Potri.T144300.1
Prunus persicappa003807m
Ricinus communis29929.m00479230190.m01129330190.m01129230190.m011291
Setaria italicaSi019475mSi009742mSi009751mSi009695m
Sorghum bicolorSb06g020270.1Sb06g020260.1Sb04g024910.1
Thellungiella halophilaThhalv10007253mThhalv10003934mThhalv10004045mThhalv10003968mThhalv10015581m
Thhalv10015466m
Vitis viniferaGSVIVT01000573001GSVIVT01019434001.470.783GSVIVT01019434001.470.783GSVIVT01019434001.35.351GSVIVT01019434001.35.351
GSVIVT01019433001GSVIVT01019436001GSVIVT01014359001GSVIVT01014358001GSVIVT01014355001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)