y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g08550.2
FamilyGH16
Protein PropertiesLength: 293 Molecular Weight: 32888.9 Isoelectric Point: 7.9297
ChromosomeChromosome/Scaffold: 07 Start: 7136168 End: 7139017
Descriptionxyloglucan endotransglucosylase/hydrolase 32
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH161002331.4e-22
  RGGARWRTASRFRSGTFSALIRCPSGDTSGLNFNLYLSSLEGDKSQDEIDFEFLGRDRTIVQTNFYSEGAGNKERIHHLGFDASDGFHEYVIVWGSDAIE
  WRVDGKVVRREERKEGEGFPEKAMFLYASVWDAS
Full Sequence
Protein Sequence     Length: 293     Download
MSANSSTKGN ATSNCLCYCR RRATIRIART TRNNRRLFYA CPLPQLNTHA FQFSALESSF    60
HIPMADAATQ PLKEIAIDYT PEACSHCATS NTITLTYDHR GGARWRTASR FRSGTFSALI    120
RCPSGDTSGL NFNLYLSSLE GDKSQDEIDF EFLGRDRTIV QTNFYSEGAG NKERIHHLGF    180
DASDGFHEYV IVWGSDAIEW RVDGKVVRRE ERKEGEGFPE KAMFLYASVW DASWVAEGKV    240
VWGSTVGVMS LMFVSRGHSC SRWNFCCGLS IHLFFIDNFS PSKRHLEAPN IN*           300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02183GH16_fungal_CRH1_transglycosylase1.0e-1314523092+
PLN03161PLN031615.0e-1689257179+
cd02175GH16_lichenase1.0e-23102200101+
cd02176GH16_XET6.0e-3191242162+
pfam00722Glyco_hydro_162.0e-3289233146+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0008270zinc ion binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY88289.106023916196hypothetical protein OsI_09745 [Oryza sativa Indica Group]
RefSeqNP_001048767.106023916196Os03g0117300 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001150346.106823819190xyloglucan endotransglucosylase/hydrolase protein 5 [Zea mays]
RefSeqXP_002273975.10642391180PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301319.10642381179predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vh9_B2e-249223762212A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2vh9_A2e-249223762212A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide
PDB2uwb_B3e-249223739189A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2uwb_A3e-249223739189A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2uwc_B2e-229223738193A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO979719179592370
BU965457142592000
CU478138200442390
EX304374172682390
FQ341684193452370
Orthologous Group
SpeciesID
Citrus clementinaCiclev10022200m
Citrus sinensisorange1.1g028023m
Eucalyptus grandisEucgr.D02237.1
Fragaria vescamrna18893.1-v1.0-hybrid
Gossypium raimondiiGorai.007G095000.2Gorai.007G095000.1
Manihot esculentacassava4.1_016069m
Physcomitrella patensPp1s24_272V6.1Pp1s353_23V6.6Pp1s353_23V6.1Pp1s353_23V6.2Pp1s353_23V6.3
Pp1s353_23V6.4Pp1s353_23V6.5
Phaseolus vulgarisPhvul.010G092400.1
Picea abiesMA_52109g0010
Populus trichocarpaPotri.002G153200.1
Prunus persicappa027011m
Setaria italicaSi039715m
Selaginella moellendorffii75086
Sorghum bicolorSb01g049420.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny