y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g12701.1
FamilyGH1
Protein PropertiesLength: 116 Molecular Weight: 12941.2 Isoelectric Point: 6.5056
ChromosomeChromosome/Scaffold: 07 Start: 11097425 End: 11098149
Descriptionbeta glucosidase 8
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH111016.4e-24
  MHNMLLPHAKAIELYRKHFQAKQRGTIGIVAFSSMCDPLRDEECDRQAVSRGLAFDIAWVLDPLVFGEYPPEMRSILGSKMPVFSPMEMSLIKGSLDFIG
  M
Full Sequence
Protein Sequence     Length: 116     Download
MHNMLLPHAK AIELYRKHFQ AKQRGTIGIV AFSSMCDPLR DEECDRQAVS RGLAFDIAWV    60
LDPLVFGEYP PEMRSILGSK MPVFSPMEMS LIKGSLDFIG MIGVPDYNLH IISAM*        120
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03356BGL1.0e-171100100+
PLN02998PLN029982.0e-201102106+
pfam00232Glyco_hydro_13.0e-221100103+
PLN02849PLN028492.0e-252102101+
PLN02814PLN028142.0e-292102101+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI20347.15e-371101234334unnamed protein product [Vitis vinifera]
GenBankEEC77636.12e-322101193292hypothetical protein OsI_16628 [Oryza sativa Indica Group]
RefSeqXP_002281979.12e-361101281381PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281986.19e-351101237337PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002329151.12e-401101205305predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2e40_B5e-232112202309A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2e40_A5e-232112202309A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
PDB2e3z_B5e-232112202309A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form
PDB2e3z_A5e-232112202309A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form
PDB2jf7_B1e-222101243342A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF54753610111010
FK460141786831.4013e-45
FK474722796835.99994e-41
FC057498971974e-34
FK505710833846e-34
Orthologous Group
SpeciesID
Linum usitatissimumLus10043093.184.345Lus10043093.184.345
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny