y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g13150.1
FamilyGT22
Protein PropertiesLength: 497 Molecular Weight: 57368.6 Isoelectric Point: 9.6354
ChromosomeChromosome/Scaffold: 07 Start: 11647649 End: 11662635
Descriptionhomolog of asparagine-linked glycosylation 12
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT22193810
  LLGSIAAFYVLTVPYTKVEESFNVQYDHLEFPGVVPRTFLVKFFVFCSHFLSKCALLVSLIAAPFVLTANLLHLPKFYALLIVWMALGCIILYTLRFFRH
  QIRNKFGHQVEAFFVILTATQFHFLFYCTRPLPNILALGLVNLAYGYWFRGRFYAALNSLIFTTTVFRCDMLLLLCPIGLQLLLTKKVSVWGALKHCTGM
  ALFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAFHWYFTSALPRSLLAAFPLSLFGLFVDRRVRSFTFPVLAFILLYSKLPHKELRFIIS
  SVPIFNLSASIASNRIYNNKKKMVWNLLFLILLGLLLMSLAGTVTSFMASYWNYPSGHALKKL
Full Sequence
Protein Sequence     Length: 497     Download
MASNSKSETF LQRNGYDFLL GSIAAFYVLT VPYTKVEESF NVQYDHLEFP GVVPRTFLVK    60
FFVFCSHFLS KCALLVSLIA APFVLTANLL HLPKFYALLI VWMALGCIIL YTLRFFRHQI    120
RNKFGHQVEA FFVILTATQF HFLFYCTRPL PNILALGLVN LAYGYWFRGR FYAALNSLIF    180
TTTVFRCDML LLLCPIGLQL LLTKKVSVWG ALKHCTGMAL FCIGLTILVD SIMWKRLLWP    240
EFEVFWFNSV LNKSSEWGTH AFHWYFTSAL PRSLLAAFPL SLFGLFVDRR VRSFTFPVLA    300
FILLYSKLPH KELRFIISSV PIFNLSASIA SNRIYNNKKK MVWNLLFLIL LGLLLMSLAG    360
TVTSFMASYW NYPSGHALKK LHGIGFHNDT DERWVHIDTF SAMNGISRFC ESDFPWRYSK    420
EEQISLQEFQ QRNFTFLINE HPVINGFKCL FIEDGFSRVR LKPGFPPIFL VKEPKVYAHG    480
NLENQNLFSQ NWPGCP*                                                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028162.0e-8223322100+
pfam03901Glyco_transf_221.0e-2578330269+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABF59128.104349513449unknown protein [Arabidopsis thaliana]
RefSeqNP_001077446.1014951493transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001077448.1014951497transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_001117214.104349513453transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002448266.101749622500hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5466EC-2.4.1.258Dol-P-Man:Man5GlcNAc2-PP-Dol α-1,3-mannosyltransferase
Transmembrane Domains
StartEnd
1534
6385
95117
130152
172194
207229
264286
342364
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG9923952541814340
EG492307296903850
EL435541326433680
EG4646052762174910
GE63389627152750
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_053_00061.1Aquca_053_00061.4Aquca_053_00061.3Aquca_053_00061.5Aquca_053_00061.6
Aquca_053_00061.2
Arabidopsis lyrata887214
Arabidopsis thalianaAT1G02145.1AT1G02145.2AT1G02145.4AT1G02145.3
Brachypodium distachyonBradi5g17390.1
Brassica rapaBra032669
Capsella rubellaCarubv10011809m
Citrus clementinaCiclev10019843m
Citrus sinensisorange1.1g010983morange1.1g010929m
Cucumis sativusCucsa.362500.1Cucsa.362500.2Cucsa.362500.8
Eucalyptus grandisEucgr.E01545.1Eucgr.E01545.2
Fragaria vescamrna05309.1-v1.0-hybrid
Glycine maxGlyma03g25680.2Glyma03g25680.1
Gossypium raimondiiGorai.004G166900.2Gorai.004G166900.4Gorai.004G166900.1Gorai.004G166900.3
Linum usitatissimumLus10019399Lus10043256
Malus domesticaMDP0000237340.174.306MDP0000237340.174.306
Manihot esculentacassava4.1_007438m
Medicago truncatulaAC202489_19.1
Mimulus guttatusmgv1a005831m
Oryza sativaLOC_Os04g46050.3LOC_Os04g46050.1LOC_Os04g46050.2
Panicum virgatumPavirv00060929m
Physcomitrella patensPp1s33_69V6.2
Phaseolus vulgarisPhvul.010G045600.2Phvul.010G045600.4Phvul.010G045600.3Phvul.010G045600.1
Populus trichocarpaPotri.002G139200.1
Ricinus communis29709.m001172
Setaria italicaSi029826m
Selaginella moellendorffii91475
Sorghum bicolorSb06g024210.1
Thellungiella halophilaThhalv10007744mThhalv10007738mThhalv10007459m
Vitis viniferaGSVIVT01018298001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny