y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g15720.2
FamilyGT59
Protein PropertiesLength: 375 Molecular Weight: 42090.5 Isoelectric Point: 9.3015
ChromosomeChromosome/Scaffold: 07 Start: 15441580 End: 15447025
DescriptionDIE2/ALG10 family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT59243730
  IVPEPYMDEIFHIPQAQQYCKGKFGSWDPMITTPPGLYYLSLAHVAALFPGFYWVEAASFSDLCSAAILRSINGVLAVVCSVILYDIVTHLNPTLNDRKA
  MLHAVVLSLYPLHWFFTFLYYTDVASVTAVLAMYLASLKKHYWFSALIGAFAVIIRQTNIIWVVFVACSGIINISVTHAKHHTKTAESDVSIQHGLAYAT
  GTNTEGFNLRRRRIVKSRDTVEHSSSSSHASSSFSSGFAHEIWSILLTLWYMKWKLLISFSPYLMVVVAFLLFVYWNGSVVLGAKEAHAVTPHFAQMLYF
  SLVSVLAQAPMHFTITQAVDLFQMFRKSRPLLYFQMFLALVVGLLSVHFF
Full Sequence
Protein Sequence     Length: 375     Download
MGKIALAVIV SLWVIPTTVM VNHIVPEPYM DEIFHIPQAQ QYCKGKFGSW DPMITTPPGL    60
YYLSLAHVAA LFPGFYWVEA ASFSDLCSAA ILRSINGVLA VVCSVILYDI VTHLNPTLND    120
RKAMLHAVVL SLYPLHWFFT FLYYTDVASV TAVLAMYLAS LKKHYWFSAL IGAFAVIIRQ    180
TNIIWVVFVA CSGIINISVT HAKHHTKTAE SDVSIQHGLA YATGTNTEGF NLRRRRIVKS    240
RDTVEHSSSS SHASSSFSSG FAHEIWSILL TLWYMKWKLL ISFSPYLMVV VAFLLFVYWN    300
GSVVLGAKEA HAVTPHFAQM LYFSLVSVLA QAPMHFTITQ AVDLFQMFRK SRPLLYFQMF    360
LALVVGLLSV HFFR*                                                     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04922DIE2_ALG103.0e-7022373355+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB85546.1013731373putative protein [Arabidopsis thaliana]
EMBLCAN64153.102837328410hypothetical protein [Vitis vinifera]
RefSeqNP_195861.2013731373DIE2/ALG10 family [Arabidopsis thaliana]
RefSeqXP_002270322.102837328376PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002509451.102737427377conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
524
5978
90112
137159
166188
285307
320339
354373
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2821882331413730
FS33453821012090
DN49573823812360
JG63833127962800
HS40986924412420
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00133.1Aquca_015_00133.2
Arabidopsis lyrata349537
Arabidopsis thalianaAT5G02410.1
Brachypodium distachyonBradi5g14887.2Bradi5g14887.1
Brassica rapaBra005722
Carica papayaevm.model.supercontig_332.7
Capsella rubellaCarubv10000761m
Chlamydomonas reinhardtiiCre01.g041300.t1.2
Citrus clementinaCiclev10011519m
Citrus sinensisorange1.1g048739m
Cucumis sativusCucsa.066170.1
Eucalyptus grandisEucgr.K03141.4Eucgr.K03141.2Eucgr.K03141.1Eucgr.K03141.3
Fragaria vescamrna18392.1-v1.0-hybrid
Glycine maxGlyma18g39540.1Glyma07g15720.1Glyma18g39540.3Glyma18g39540.2Glyma18g39540.4
Gossypium raimondiiGorai.006G173000.3Gorai.006G173000.2.124.415Gorai.006G173000.2.124.415Gorai.006G173000.1Gorai.006G173000.2.24.120
Gorai.006G173000.2.24.120
Linum usitatissimumLus10003973Lus10023796
Malus domesticaMDP0000243427MDP0000253085.40.432
Manihot esculentacassava4.1_005887m
Medicago truncatulaMedtr7g060680.1
Mimulus guttatusmgv1a004812m
Oryza sativaLOC_Os04g42490.1
Panicum virgatumPavirv00026323mPavirv00012327m
Physcomitrella patensPp1s284_48V6.1
Phaseolus vulgarisPhvul.008G100900.1
Picea abiesMA_7300864g0010
Populus trichocarpaPotri.006G084800.3Potri.006G084800.1Potri.006G084800.2Potri.006G084800.4
Prunus persicappa004442m
Ricinus communis30190.m011330
Setaria italicaSi010163mSi009897m
Selaginella moellendorffii96516
Sorghum bicolorSb06g021800.2Sb06g021800.1
Thellungiella halophilaThhalv10013300m
Vitis viniferaGSVIVT01034179001
Volvox carteriVocar20009545m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny