y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g30200.1
FamilyGT1
Protein PropertiesLength: 451 Molecular Weight: 49806.9 Isoelectric Point: 6.51
ChromosomeChromosome/Scaffold: 07 Start: 35251101 End: 35252453
DescriptionUDP-glucosyl transferase 78D2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12374284.7e-35
  QSLLYIVPVRFPILSVADSTGCLSWLDMQGSRSVAYVSFGTVVTPPPHEIVAVAEALEESELPFLWSLKENVLGFLPTGFLERTSMSGRIVYWAPQTQVL
  AHDSVGVFVTHCGSNSVTESLSSGVPMICRPFFGDQGVAARVIQDLWEIGVIIEGRVFTKDGLLKSLKMIMVQEEGKKIRDNALKLKKTVED
Full Sequence
Protein Sequence     Length: 451     Download
MPIMSNSTEN KHVAVFAFPF GTHTVPLLNL VLKLSQAAPN CSFSFIGTEK SNAIHFPKPH    60
IPINIKPYCI SDGIPEGHPL ANHPIEKLNF FLRTGHENLH KGIQMAEEET KQKVTCVISD    120
AFVSSSLVVA QKLNVPWIAF WPPMSCTLSL YFYIDLIREQ FLNSAGNAAF DFLPGLPNMR    180
VEDMPQDLLF FGEKETIFSK TLVSLGKVLP QAKVVVMNFF EELDPPLFVQ DMRSKLQSLL    240
YIVPVRFPIL SVADSTGCLS WLDMQGSRSV AYVSFGTVVT PPPHEIVAVA EALEESELPF    300
LWSLKENVLG FLPTGFLERT SMSGRIVYWA PQTQVLAHDS VGVFVTHCGS NSVTESLSSG    360
VPMICRPFFG DQGVAARVIQ DLWEIGVIIE GRVFTKDGLL KSLKMIMVQE EGKKIRDNAL    420
KLKKTVEDAA RPAGKSAHDL KTLLEVISSS *                                   480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02173PLN021733.0e-3612449462+
PLN02210PLN022106.0e-405448474+
PLN02562PLN025623.0e-4018420430+
PLN02448PLN024483.0e-451448485+
PLN02555PLN025554.0e-474445478+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU17764.1094504447unknown [Glycine max]
GenBankADC96620.1094504447UF3GT [Glycine max]
DDBJBAF49289.1094503447UDP-glucose:anthocyanin 3',5'-O-glucosyltransferase [Clitoria ternatea]
DDBJBAF49297.10114505446UDP-glucose:anthocyanidin 3-O-glucosyltransferase [Clitoria ternatea]
DDBJBAF49298.1094503446UDP-glucose:flavonoid 3-O-glucosyltransferase [Clitoria ternatea]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2c9z_A044481451A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2c1z_A044481451A Chain A, Crystal Structure Of Nasturtium Xyloglucan Hydrolase Isoform Nxg2
PDB2c1x_A044481451A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbj_A01244915454A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification
PDB3hbf_A01244915454A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV26450123692440
EH26008126842610
CV53017129032840
CV53001429032840
CO9812542452214510
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_031_00073.1Aquca_031_00072.1
Arabidopsis lyrata488567326139313693488566
Arabidopsis thalianaAT5G17040.1AT1G30530.1AT5G17050.1AT5G17030.1
Brachypodium distachyonBradi1g46850.1
Brassica rapaBra023594
Carica papayaevm.model.supercontig_95.70
Capsella rubellaCarubv10000798m
Citrus clementinaCiclev10008258mCiclev10019770mCiclev10030331m
Citrus sinensisorange1.1g012893morange1.1g013878m
Cucumis sativusCucsa.092240.1Cucsa.089640.1
Eucalyptus grandisEucgr.A02964.3Eucgr.A02964.1Eucgr.E02976.1Eucgr.E02345.1Eucgr.I02607.1
Eucgr.E02973.1Eucgr.E02977.1Eucgr.C00191.1Eucgr.A02964.2Eucgr.E02398.1
Eucgr.C01022.1Eucgr.C00833.1Eucgr.A00303.1Eucgr.A00306.1Eucgr.C01021.1
Eucgr.C01020.1Eucgr.C01017.1Eucgr.D00702.1Eucgr.C00831.1Eucgr.L02741.1
Eucgr.L02520.1Eucgr.C01063.1Eucgr.E02978.1Eucgr.A00304.1
Fragaria vescamrna30947.1-v1.0-hybridmrna12591.1-v1.0-hybridmrna19962.1-v1.0-hybridmrna24693.1-v1.0-hybridmrna11466.1-v1.0-hybrid
mrna11467.1-v1.0-hybridmrna13747.1-v1.0-hybridmrna29614.1-v1.0-hybrid
Glycine maxGlyma13g01220.1Glyma07g30180.1Glyma08g07130.1Glyma07g30190.1Glyma13g32910.1
Glyma17g07341.1Glyma15g06390.1Glyma06g39350.2Glyma0060s00320.2
Gossypium raimondiiGorai.003G051800.1Gorai.004G101100.1Gorai.012G009400.1Gorai.012G009300.1Gorai.012G009500.1
Gorai.010G063400.1Gorai.009G050700.1Gorai.008G018000.1
Linum usitatissimumLus10025854
Malus domesticaMDP0000543445MDP0000638691MDP0000478252MDP0000405936
Manihot esculentacassava4.1_007209mcassava4.1_031308mcassava4.1_033139mcassava4.1_028603m
Medicago truncatulaMedtr4g128690.1Medtr4g128720.1
Mimulus guttatusmgv1a006133mmgv1a006788m
Oryza sativaLOC_Os06g09240.1LOC_Os07g05420.1
Panicum virgatumPavirv00029337mPavirv00050970mPavirv00041516mPavirv00063020m
Phaseolus vulgarisPhvul.006G201100.1Phvul.002G214500.1Phvul.003G148300.1Phvul.002G214300.1Phvul.002G214400.1
Populus trichocarpaPotri.013G118700.1Potri.018G096000.1Potri.006G171100.1Potri.006G171200.1Potri.013G143900.1
Potri.009G133300.1Potri.009G078400.1Potri.019G090400.1
Prunus persicappa015939mppa019430mppa015221mppa017941mppa005162m
Ricinus communis28479.m00004729804.m00155830073.m002239
Setaria italicaSi006338mSi010039m
Selaginella moellendorffii105043445660
Sorghum bicolorSb10g006140.1Sb02g038860.1
Thellungiella halophilaThhalv10013472m
Vitis viniferaGSVIVT01037410001GSVIVT01037413001GSVIVT01029129001GSVIVT01029126001GSVIVT01029122001
GSVIVT01024419001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)