y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g30750.1
FamilyAA6
Protein PropertiesLength: 208 Molecular Weight: 21998.2 Isoelectric Point: 6.9718
ChromosomeChromosome/Scaffold: 07 Start: 35704416 End: 35707827
Descriptionflavodoxin-like quinone reductase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA672010
  KVYIVYYSMYGHVEKLAEEIKKGAASVEGVEAKLWQVPETLPQEVLGKMGAPPKSDVPIITPNELPEADGLLLGFPTRFGLMAAQFKAFLDATGGLWRTQ
  ALAGKPAGIFYSTGSQGGGQETTPLTSITQLVHHGMIFVPIGYTFGAGMFEMENVKGGSPYGAGTYAGDGSRQPTELELAQAFHQGKYFAGIAKK
Full Sequence
Protein Sequence     Length: 208     Download
MATTTTKVYI VYYSMYGHVE KLAEEIKKGA ASVEGVEAKL WQVPETLPQE VLGKMGAPPK    60
SDVPIITPNE LPEADGLLLG FPTRFGLMAA QFKAFLDATG GLWRTQALAG KPAGIFYSTG    120
SQGGGQETTP LTSITQLVHH GMIFVPIGYT FGAGMFEMEN VKGGSPYGAG TYAGDGSRQP    180
TELELAQAFH QGKYFAGIAK KLKGSSQ*                                       240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03358FMN_red2.0e-820149132+
pfam00258Flavodoxin_11.0e-910116119+
COG0655WrbA2.0e-356204206+
TIGR01755flav_wrbA5.0e-626202198+
PRK03767PRK037672.0e-746204200+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0010181FMN binding
GO:0016491oxidoreductase activity
GO:0050662coenzyme binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU13157.1052073205unknown [Glycine max]
GenBankACU19740.1012071207unknown [Glycine max]
EMBLCAD31838.1052053203putative quinone oxidoreductase [Cicer arietinum]
RefSeqXP_002518592.1062063203Flavoprotein wrbA, putative [Ricinus communis]
RefSeqXP_002534445.1062063203Minor allergen Alt a, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3b6m_B072043198A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3b6m_A072043198A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3b6k_B072043198A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3b6k_A072043198A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3b6j_B072043198A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX70390420812080
FK00747420452080
EV27962920452080
EV28110120452080
EV26297520452080
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00427.1Aquca_028_00272.1Aquca_028_00272.2Aquca_045_00040.1Aquca_028_00272.4
Aquca_028_00272.3Aquca_045_00041.1
Arabidopsis lyrata912689492071495531497377496008
Arabidopsis thalianaAT4G36750.1AT4G27270.1AT5G54500.1AT5G58800.2AT5G58800.1
AT5G54500.2
Brachypodium distachyonBradi3g27210.2Bradi2g51980.1Bradi2g20710.2Bradi1g59450.1Bradi1g59440.1
Bradi1g08640.1Bradi2g20710.1
Brassica rapaBra017781Bra029025Bra022724Bra002982Bra020352
Bra026364Bra020939Bra024671Bra033447Bra026424
Bra015354Bra026588Bra028316Bra013991
Carica papayaevm.model.supercontig_62.114evm.model.supercontig_12.2evm.model.supercontig_27.163evm.model.supercontig_112.39
Capsella rubellaCarubv10007228mCarubv10027151mCarubv10027183mCarubv10005724mCarubv10027138m
Chlamydomonas reinhardtiiCre10.g456000.t1.2Cre10.g456050.t2.1Cre10.g456050.t1.2Cre10.g456100.t1.2g11188.t1
Citrus clementinaCiclev10026310mCiclev10029120mCiclev10009497mCiclev10009518mCiclev10016752m
Ciclev10029300mCiclev10009723mCiclev10017062mCiclev10029304m
Citrus sinensisorange1.1g024934morange1.1g040588morange1.1g029532morange1.1g028841morange1.1g029479m
orange1.1g028847morange1.1g028917morange1.1g031039morange1.1g031827morange1.1g031823m
orange1.1g031807morange1.1g031886m
Cucumis sativusCucsa.104940.1Cucsa.109910.1Cucsa.059590.1Cucsa.045690.1Cucsa.045690.2
Cucsa.139160.1
Eucalyptus grandisEucgr.I01248.1Eucgr.D00882.1Eucgr.F03383.1Eucgr.B02266.3Eucgr.B02266.2
Eucgr.B02266.1Eucgr.B02266.4Eucgr.I01248.2Eucgr.I02466.1
Fragaria vescamrna29536.1-v1.0-hybridmrna02174.1-v1.0-hybridmrna03258.1-v1.0-hybridmrna30664.1-v1.0-hybridmrna07872.1-v1.0-hybrid
Glycine maxGlyma11g06920.1Glyma01g38400.1Glyma11g12790.1Glyma12g04940.1Glyma12g17680.1
Glyma12g34500.2Glyma12g34500.1Glyma12g17680.2Glyma13g35994.1Glyma12g25950.1
Glyma08g06570.1Glyma15g07040.2Glyma15g07040.1Glyma13g32300.1Glyma13g32300.2
Glyma14g37150.3Glyma14g37150.2Glyma14g37150.1Glyma13g32310.1Glyma06g40750.2
Glyma06g40700.1Glyma12g25950.2Glyma06g40730.1Glyma08g06570.2Glyma06g39970.1
Glyma19g02750.2Glyma04g13531.1Glyma06g40810.2Glyma12g23000.2Glyma14g22010.1
Glyma11g33050.2
Gossypium raimondiiGorai.003G016700.1Gorai.005G228800.3Gorai.005G228800.2Gorai.005G228800.1Gorai.007G206100.3
Gorai.007G206100.1Gorai.008G069000.1Gorai.009G429200.1Gorai.002G079100.1Gorai.011G020200.1
Gorai.003G123300.6Gorai.003G123300.5Gorai.003G123300.4Gorai.003G123300.2Gorai.003G123300.1
Gorai.003G123300.7Gorai.003G123300.8Gorai.009G429200.2Gorai.002G079100.2Gorai.003G123300.9
Gorai.007G206100.2Gorai.003G123300.3
Linum usitatissimumLus10014325Lus10026035Lus10041718Lus10040486Lus10018401
Lus10007612Lus10006748Lus10020076Lus10005862Lus10024032
Malus domesticaMDP0000404722MDP0000301453MDP0000896493MDP0000393227MDP0000509613
MDP0000829416MDP0000295439MDP0000181421.64.175MDP0000181421.64.175MDP0000181421.214.283
MDP0000181421.214.283MDP0000667053
Manihot esculentacassava4.1_013993mcassava4.1_015848mcassava4.1_016492mcassava4.1_016498mcassava4.1_016478m
cassava4.1_030159mcassava4.1_016500m
Medicago truncatulaMedtr5g019620.1Medtr2g081810.1Medtr5g070030.1Medtr2g011080.1Medtr2g011080.2
Mimulus guttatusmgv1a011919mmgv1a026744mmgv1a014007mmgv1a013996mmgv1a014020m
mgv1a013995m
Oryza sativaLOC_Os01g57570.1LOC_Os05g42190.1LOC_Os08g04460.1LOC_Os03g53730.1LOC_Os01g57570.2
LOC_Os08g04460.2
Panicum virgatumPavirv00064613mPavirv00046437mPavirv00014837mPavirv00023949mPavirv00031126m
Pavirv00039933mPavirv00036713mPavirv00019037m
Physcomitrella patensPp1s475_5V6.5Pp1s475_5V6.4Pp1s475_5V6.3Pp1s475_5V6.2Pp1s475_5V6.1
Pp1s32_160V6.1Pp1s55_98V6.1Pp1s352_29V6.1Pp1s227_23V6.1Pp1s114_114V6.1
Pp1s270_78V6.1
Phaseolus vulgarisPhvul.002G027100.1Phvul.011G047200.1Phvul.011G152500.1Phvul.005G088900.1Phvul.005G088900.2
Phvul.006G194800.1Phvul.002G219700.1Phvul.006G194900.1Phvul.008G262200.1Phvul.011G152900.1
Phvul.005G088900.3Phvul.011G152800.1Phvul.011G153100.1
Picea abiesMA_125690g0020MA_10426786g0010MA_10434600g0010MA_206492g0010MA_159008g0220
MA_28841g0010MA_479276g0010
Populus trichocarpaPotri.007G029600.1Potri.005G126200.1Potri.004G151100.1Potri.001G410700.1Potri.011G129400.2
Potri.011G129400.1Potri.004G028900.1Potri.011G033100.1Potri.009G044400.7Potri.009G044400.6
Potri.009G044400.5Potri.009G044400.1Potri.009G044400.4Potri.009G044400.2Potri.011G033100.2
Potri.009G044400.3
Prunus persicappa011578mppa010049mppa011617mppa011600mppa011625m
ppa011865m
Ricinus communis29646.m00106529851.m00244127733.m00003229842.m00370529681.m001326
Setaria italicaSi037123mSi023271mSi015648mSi002660mSi031096m
Selaginella moellendorffii229897232063
Sorghum bicolorSb01g021290.2Sb01g021290.1Sb03g036660.1Sb02g000630.1Sb09g024730.2
Sb09g024730.1Sb02g006210.1Sb03g036660.2Sb04g023400.1
Thellungiella halophilaThhalv10025964mThhalv10014706mThhalv10026307mThhalv10014693mThhalv10014690m
Thhalv10014688m
Vitis viniferaGSVIVT01031920001GSVIVT01014540001GSVIVT01005305001GSVIVT01019014001GSVIVT01005278001
GSVIVT01005303001GSVIVT01024768001
Volvox carteriVocar20014747mVocar20014778m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)