y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g31970.1
FamilyCBM57
Protein PropertiesLength: 498 Molecular Weight: 55460 Isoelectric Point: 5.8544
ChromosomeChromosome/Scaffold: 07 Start: 36913370 End: 36919204
Descriptionreceptor like protein 4
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM572433596.2e-24
  KQASHPPNFYPETLYQSALVSTNNEPDLTYALEVDPNRNYSVWLHFAEIDNSVTAAGQRVFNIIINDDHAFKDVDIVELSGDIYTALVLNTTVTVNGRIL
  TITLKPKEGNLAIINAI
Full Sequence
Protein Sequence     Length: 498     Download
MLLRFLQLWI MLRFACVSCA ARQDPFAMHI SCGARQNVQT KPTNTLWRED FGFTGGIAAN    60
ATRPSFITPP LNTLRYFPLS EGPQNCYNIN KVPKGHYSIR IFFGLVGRSK DTSEPLFDIS    120
IEGTQIYSLK PGWNKQNDQV FVEALVFLTN DSVSICFHST GHGDPAILSI EIQQIDDKAY    180
YFGPWWSQGI ILRTVKRLSC GFGQSKFDVD YGGDSRGGDR FWQRIKTFGD ESDQPRSVET    240
RIKQASHPPN FYPETLYQSA LVSTNNEPDL TYALEVDPNR NYSVWLHFAE IDNSVTAAGQ    300
RVFNIIINDD HAFKDVDIVE LSGDIYTALV LNTTVTVNGR ILTITLKPKE GNLAIINAIE    360
IFEVIMVESK TISEEVSALQ TLKKALGLPP RFGWNGDPCV PQQHPWFGVD CQLNKSSGSW    420
IIDGLGLDNQ GLKGFLPDDI SRLLNLQILN LSKNNIHGAI PSLLGTITSL QVLDLSYNLF    480
SGSIPESLGQ LTSLQRL*                                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11721Malectin0.000228170159+
PLN00113PLN001133.0e-1042549773+
pfam11721Malectin1.0e-13254359118+
pfam12819Malectin_like5.0e-7030364350+
PLN03150PLN0315006497495+
Gene Ontology
GO TermDescription
GO:0005515protein binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI30598.102549724497unnamed protein product [Vitis vinifera]
RefSeqNP_174156.1014971498AtRLP4 (Receptor Like Protein 4); protein binding [Arabidopsis thaliana]
RefSeqXP_002279791.10284971473PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305781.10284971470predicted protein [Populus trichocarpa]
RefSeqXP_002509445.1024971503serine-threonine protein kinase, plant-type, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hq1_A0.000000000637549728140B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB4hq1_A0.0001375485324427B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3rj0_A0.000002432497641706B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3rj0_A0.000002425488492555B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
PDB3rj0_A0.00001422494465537B Chain B, Structural Basis Of Gibberellin(Ga3)-Induced Della Recognition By The Gibberellin Receptor
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO809175179502280
HO8091751812254050
EX13355229262970
HO790281231983280
FG939605223302520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01105.1Aquca_026_00194.1Aquca_036_00074.1
Arabidopsis thalianaAT1G28340.1
Brachypodium distachyonBradi1g26830.1
Brassica rapaBra032897
Carica papayaevm.model.supercontig_27.21
Capsella rubellaCarubv10008578m
Citrus clementinaCiclev10014874mCiclev10014609m
Citrus sinensisorange1.1g013887morange1.1g012913morange1.1g010819morange1.1g009515morange1.1g007860m
orange1.1g007307morange1.1g006793morange1.1g015373morange1.1g009603morange1.1g009236m
orange1.1g006940morange1.1g006035m
Cucumis sativusCucsa.147330.1Cucsa.126850.1
Eucalyptus grandisEucgr.G02346.3Eucgr.E03253.2Eucgr.E03253.1Eucgr.D00605.1
Fragaria vescamrna03872.1-v1.0-hybridmrna29734.1-v1.0-hybrid
Glycine maxGlyma02g11090.2Glyma02g11090.1Glyma01g22406.1Glyma20g32720.1Glyma15g08350.4
Glyma15g08350.3Glyma13g31020.4Glyma13g31020.3Glyma13g24550.1Glyma07g31970.2
Gossypium raimondiiGorai.005G138000.3Gorai.005G138000.2Gorai.005G138000.1Gorai.011G029600.2Gorai.011G029600.1
Gorai.006G087900.8Gorai.006G087900.7Gorai.006G087900.6Gorai.006G087900.5Gorai.006G087900.4
Gorai.006G087900.3Gorai.006G087900.2Gorai.006G087900.1
Linum usitatissimumLus10041488Lus10034275Lus10015417Lus10013994Lus10015320
Malus domesticaMDP0000298053MDP0000124675
Manihot esculentacassava4.1_031190mcassava4.1_008047mcassava4.1_003726mcassava4.1_003546mcassava4.1_034042m
Medicago truncatulaMedtr5g053610.1Medtr2g014290.1
Mimulus guttatusmgv1a002935m
Oryza sativaLOC_Os07g31840.1
Panicum virgatumPavirv00022924mPavirv00022923mPavirv00008373m
Physcomitrella patensPp1s83_48V6.1Pp1s199_124V6.1Pp1s5_311V6.1Pp1s1_97V6.1Pp1s2_327V6.1
Pp1s6_364V6.1
Phaseolus vulgarisPhvul.007G102400.1Phvul.003G027500.1Phvul.006G183300.2Phvul.006G183300.1Phvul.002G230800.1
Phvul.003G239400.1
Picea abiesMA_199958g0010MA_41304g0010
Populus trichocarpaPotri.010G129300.3Potri.010G129300.2Potri.010G129300.1Potri.008G117000.2Potri.008G117000.1
Potri.011G056800.2Potri.011G056800.1Potri.004G047300.4Potri.004G047300.3Potri.004G047300.2
Potri.004G047300.1
Prunus persicappa002857mppa003081m
Ricinus communis29738.m00104930190.m011324
Setaria italicaSi029205m
Selaginella moellendorffii133089
Sorghum bicolorSb02g034070.1
Thellungiella halophilaThhalv10007074m
Vitis viniferaGSVIVT01021096001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)