y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g34710.1
FamilyGT76
Protein PropertiesLength: 498 Molecular Weight: 56057.5 Isoelectric Point: 9.322
ChromosomeChromosome/Scaffold: 07 Start: 39724045 End: 39728109
Descriptiontransferases, transferring hexosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT76204970
  VLKSAICSRLLLVTLIILFRTLVSPYDTSASLNPPCLSTPNPNSTTHPSPLENGVVWDSVYFLRIAQCGYEYEQTFAFLPLLPLSLSLSSHTLFAFLSPF
  LNQRPLLALSAYVINNMAFVLAALYFYKLSLTVLKDPQIALRATVFFCFNPASIFYSSIYSESLYALLCFGGMYHFMSGGNNLAVLFFALSGCARSNGVL
  NAGYLCFQTMHRAYHAMFQEKRVTLALQIVIAGALRTACIFAPFVAFQAYGYYNMCVGRSPDEIRPWCKARIPLLYNYIQSHYWGVGFLRYFQLKQLPNF
  LLASPILSLALCSVVHYAKSRPQNFLSLGFLAPMEEKSRGVVFLLDELSRSKEARSVKKSSVRVEEHSNLRRRKNVSKGDAANVHLESEPAAIWPGYLSA
  SVLPFVLHLGFMACTAFFIMHVQVSTRFLSASPPLYWFASYIMAYPGKYSRWGYVMWAYSIAYIFLGSLLFSNFYPFT
Full Sequence
Protein Sequence     Length: 498     Download
MVETLPHHTP PPPNHHQVLV LKSAICSRLL LVTLIILFRT LVSPYDTSAS LNPPCLSTPN    60
PNSTTHPSPL ENGVVWDSVY FLRIAQCGYE YEQTFAFLPL LPLSLSLSSH TLFAFLSPFL    120
NQRPLLALSA YVINNMAFVL AALYFYKLSL TVLKDPQIAL RATVFFCFNP ASIFYSSIYS    180
ESLYALLCFG GMYHFMSGGN NLAVLFFALS GCARSNGVLN AGYLCFQTMH RAYHAMFQEK    240
RVTLALQIVI AGALRTACIF APFVAFQAYG YYNMCVGRSP DEIRPWCKAR IPLLYNYIQS    300
HYWGVGFLRY FQLKQLPNFL LASPILSLAL CSVVHYAKSR PQNFLSLGFL APMEEKSRGV    360
VFLLDELSRS KEARSVKKSS VRVEEHSNLR RRKNVSKGDA ANVHLESEPA AIWPGYLSAS    420
VLPFVLHLGF MACTAFFIMH VQVSTRFLSA SPPLYWFASY IMAYPGKYSR WGYVMWAYSI    480
AYIFLGSLLF SNFYPFT*                                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04188Mannosyl_trans26.0e-1442049786+
COG5542COG55427.0e-15119326212+
pfam04188Mannosyl_trans29.0e-8820339321+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAC17633.101449711492Contains similarity to hypothetical protein C18b11.05 gb
GenBankABC75356.10144979486Protein of unknown function DUF409 [Medicago truncatula]
RefSeqNP_172652.201449711489transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002283435.10144979497PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002527781.10144976500conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
2042
94116
131153
165187
202224
244266
315337
421443
472494
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BE1903771872904760
CV5336022601213800
DV1444202351233570
HO7830321841793620
HO7830321333214521e-36
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00449.3Aquca_013_00449.2Aquca_013_00449.1
Arabidopsis lyrata471336
Arabidopsis thalianaAT1G11880.1
Brachypodium distachyonBradi4g06960.1
Brassica rapaBra031787Bra016807
Carica papayaevm.model.supercontig_1833.2
Capsella rubellaCarubv10008966m
Chlamydomonas reinhardtiiCre07.g320650.t1.3
Citrus clementinaCiclev10015009m
Citrus sinensisorange1.1g018572morange1.1g020868morange1.1g022022morange1.1g011059m
Cucumis sativusCucsa.142860.1Cucsa.142850.1
Eucalyptus grandisEucgr.F02225.1
Fragaria vescamrna24756.1-v1.0-hybrid
Glycine maxGlyma07g34710.2
Gossypium raimondiiGorai.011G002800.4.154.470Gorai.011G002800.6Gorai.011G002800.3Gorai.011G002800.2Gorai.011G002800.4.154.470
Gorai.011G002800.5Gorai.011G002800.4.21.155Gorai.011G002800.1Gorai.011G002800.4.21.155
Linum usitatissimumLus10000535
Malus domesticaMDP0000302238MDP0000268496MDP0000210920MDP0000206274MDP0000255613
MDP0000165902
Manihot esculentacassava4.1_021982mcassava4.1_013936m
Medicago truncatulaMedtr4g084070.1
Mimulus guttatusmgv1a006152m
Oryza sativaLOC_Os12g31480.1
Panicum virgatumPavirv00004639mPavirv00008794m
Physcomitrella patensPp1s58_115V6.1
Phaseolus vulgarisPhvul.002G098000.2Phvul.009G191800.1Phvul.002G098000.1
Picea abiesMA_93868g0010MA_10427477g0010
Populus trichocarpaPotri.003G216900.1Potri.003G216900.3Potri.003G216900.2Potri.003G216900.4Potri.003G216900.5
Prunus persicappa004654m
Ricinus communis29692.m000527
Setaria italicaSi021856m
Selaginella moellendorffii268247
Sorghum bicolorSb03g024000.1
Thellungiella halophilaThhalv10007452m
Vitis viniferaGSVIVT01025407001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny