y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g34965.1
FamilyGT65
Protein PropertiesLength: 431 Molecular Weight: 49043.5 Isoelectric Point: 8.1367
ChromosomeChromosome/Scaffold: 07 Start: 40048656 End: 40051045
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65701894.4e-32
  GLNNQKIAFARACHTARTMNRILLMPSLSASLFYKEIDLLQPISFDRVFQYDKFNALCSGFVQLGRYSDLSNQTRVLEMQKGSGRKWTVERDLDQLRDYS
  KGEFEDHEVIRIVGKNPFLW
GT651893780
  WHDHWPVKDYAKVFECLVLIDEIGREADRVVSRIRAVGRETQSNSESVELENDSSSFQPLPYVAVHMRVEIDWMIHCKKLEQRLNTNQICSSKKEIMERV
  ANIKGLKTPSVVYLAVADKLLQNSSVLEGWEEGFLPYEKKKLGVDGIYKKYPYLIQSAIDYEVCLRADIFVGNSFSTFSSLIVLERTQKI
Full Sequence
Protein Sequence     Length: 431     Download
MGGGTVKSLT CKFVFLLVAL LILRALLVPP SPGFGGVEWS NFVYIRNHSP SFGVGVRQDK    60
FLEVPQIVWG LNNQKIAFAR ACHTARTMNR ILLMPSLSAS LFYKEIDLLQ PISFDRVFQY    120
DKFNALCSGF VQLGRYSDLS NQTRVLEMQK GSGRKWTVER DLDQLRDYSK GEFEDHEVIR    180
IVGKNPFLWH DHWPVKDYAK VFECLVLIDE IGREADRVVS RIRAVGRETQ SNSESVELEN    240
DSSSFQPLPY VAVHMRVEID WMIHCKKLEQ RLNTNQICSS KKEIMERVAN IKGLKTPSVV    300
YLAVADKLLQ NSSVLEGWEE GFLPYEKKKL GVDGIYKKYP YLIQSAIDYE VCLRADIFVG    360
NSFSTFSSLI VLERTQKIIT MGVNMCGKDV TWPSYAYNIQ GESNGPMRWV TNMSHSTLQE    420
ISYGTNHISC *                                                         480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.003619535+
cd11302O-FucT-12.0e-5249374148+
cd11299O-FucT_plant3.0e-1270375333+
cd11296O-FucT_like6.0e-25191375189+
pfam10250O-FucT5.0e-3770375337+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187183.30743015442unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.1094301427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321799.10884302347predicted protein [Populus trichocarpa]
RefSeqXP_002332132.10884302347predicted protein [Populus trichocarpa]
RefSeqXP_002531235.10343014446conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.000003249374212344A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
PDB3zy5_A0.000003249374212344A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
PDB3zy4_A0.000003249374212344A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
PDB3zy3_B0.000003249374212344A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
PDB3zy3_A0.000003249374212344A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde
Transmembrane Domains
StartEnd
1335
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FK000039228382640
DW5174702681694310
DW5173972511694140
GW9648112331974290
GO8579223041304300
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378
Glyma07g34965.3.189.378Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189
Glyma07g34965.3.70.189Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny