y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma07g37751.1
FamilyGT47
Protein PropertiesLength: 129 Molecular Weight: 14626 Isoelectric Point: 8.7481
ChromosomeChromosome/Scaffold: 07 Start: 42712062 End: 42713692
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT472802.5e-23
  RPMLSASFCLQPPGDTTTRRSTFDAVLAGCIPVFFEELSAKAQYGWHLPEAEFEELSVFIPKEEVVFRGMRILDVLQQI
Full Sequence
Protein Sequence     Length: 129     Download
MRPMLSASFC LQPPGDTTTR RSTFDAVLAG CIPVFFEELS AKAQYGWHLP EAEFEELSVF    60
IPKEEVVFRG MRILDVLQQI PRGRVRRMRE RVLELMPSVF YRKHNSSPGL KTKKDAVDLA    120
 IDGTLDKI*                                                           180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin9.0e-2018083+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_193989.101128304431exostosin family protein [Arabidopsis thaliana]
RefSeqXP_002267390.101128307434PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002304426.101128298425predicted protein [Populus trichocarpa]
RefSeqXP_002329867.101128301428predicted protein [Populus trichocarpa]
RefSeqXP_002529790.101128318445catalytic, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CD01236712811280
CD01333812811280
GD17477112721280
EC95251412811280
FR63211412811280
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_013_00701.1Aquca_025_00047.1Aquca_038_00043.1Aquca_003_00092.1Aquca_013_00533.1
Aquca_030_00256.1
Arabidopsis lyrata480865901861359365902333493853
915506344960482210492611919476
339091893098920989
Arabidopsis thalianaAT2G29040.1AT2G20370.1AT5G41250.1AT1G63450.1AT2G32750.1
AT4G13990.1AT4G22580.1AT2G31990.1AT2G32740.1AT5G62220.1
AT1G68470.1
Brachypodium distachyonBradi1g75450.1Bradi3g28020.1Bradi3g28027.1Bradi1g13110.1Bradi3g28012.1
Bradi3g28006.1Bradi3g32980.1Bradi3g28040.1Bradi1g78280.1Bradi5g18940.1
Bradi5g18927.1Bradi3g47480.1Bradi4g40070.1
Brassica rapaBra036680Bra036467Bra022900Bra028388Bra035655
Bra028492Bra022874Bra027802Bra005627Bra038960
Bra005559Bra021811Bra010065Bra004310Bra021763
Bra013627
Carica papayaevm.model.supercontig_29.130evm.model.supercontig_8.309evm.model.supercontig_81.132evm.model.supercontig_157.42evm.model.supercontig_3.255
evm.model.supercontig_157.43evm.model.supercontig_74.20
Capsella rubellaCarubv10025159mCarubv10013229mCarubv10023021mCarubv10006479mCarubv10025252m
Carubv10021808mCarubv10007051mCarubv10025326mCarubv10004820mCarubv10028275m
Carubv10020285m
Citrus clementinaCiclev10020110mCiclev10004973mCiclev10006440mCiclev10004838mCiclev10004905m
Ciclev10004921mCiclev10006490m
Citrus sinensisorange1.1g007197morange1.1g012984morange1.1g045731morange1.1g046652morange1.1g011220m
orange1.1g012090morange1.1g016487morange1.1g047350m
Cucumis sativusCucsa.140650.1Cucsa.320620.1Cucsa.135930.1Cucsa.095020.1Cucsa.125430.1
Cucsa.251330.1Cucsa.104410.1Cucsa.115600.1
Eucalyptus grandisEucgr.E00459.1Eucgr.A01318.1Eucgr.B02354.1Eucgr.H00492.1Eucgr.H02673.1
Eucgr.D01858.1Eucgr.A02868.1Eucgr.H02667.1Eucgr.D00738.1Eucgr.H00343.1
Fragaria vescamrna08349.1-v1.0-hybridmrna06574.1-v1.0-hybridmrna29211.1-v1.0-hybridmrna32241.1-v1.0-hybridmrna02225.1-v1.0-hybrid
mrna32454.1-v1.0-hybridmrna06576.1-v1.0-hybridmrna13394.1-v1.0-hybridmrna06572.1-v1.0-hybridmrna16329.1-v1.0-hybrid
mrna16326.1-v1.0-hybridmrna06573.1-v1.0-hybridmrna16325.1-v1.0-hybrid
Glycine maxGlyma13g18940.3Glyma13g18940.2Glyma10g04640.1Glyma19g35210.3Glyma19g35210.2
Glyma03g32481.1Glyma17g02880.1Glyma18g00560.1Glyma11g36640.1Glyma18g52010.1
Glyma18g52000.2Glyma11g02640.1Glyma08g29110.2Glyma20g29030.2Glyma20g00760.1
Gossypium raimondiiGorai.007G150100.1Gorai.003G169500.1Gorai.006G224200.1Gorai.004G211300.1Gorai.011G152000.1
Gorai.001G111200.1Gorai.011G152600.1Gorai.006G226500.1Gorai.008G283000.3Gorai.008G283000.2
Gorai.008G283000.1Gorai.007G009300.1Gorai.009G098600.1Gorai.005G266400.1Gorai.009G374500.1
Gorai.001G182200.1
Linum usitatissimumLus10022862Lus10024961Lus10007037Lus10000604Lus10028924
Lus10006694Lus10016532Lus10004341Lus10001578Lus10004967
Lus10007426Lus10010677Lus10001028Lus10027386Lus10031685
Lus10015022Lus10013701Lus10005566Lus10013700Lus10005567
Lus10003440
Malus domesticaMDP0000697213MDP0000669665MDP0000204575MDP0000224103MDP0000315108
MDP0000317620MDP0000775334MDP0000899392MDP0000186840MDP0000661731
MDP0000317931MDP0000317621MDP0000839295MDP0000306185MDP0000301100
MDP0000828513MDP0000951395MDP0000131360MDP0000130660MDP0000133266
MDP0000290571MDP0000322393MDP0000132843MDP0000630192
Manihot esculentacassava4.1_004268mcassava4.1_004031mcassava4.1_032775mcassava4.1_007677mcassava4.1_026371m
cassava4.1_007928mcassava4.1_022618mcassava4.1_025515mcassava4.1_021548mcassava4.1_033519m
cassava4.1_005862mcassava4.1_023212mcassava4.1_029120m
Medicago truncatulaMedtr7g098650.1Medtr4g119810.1Medtr3g084400.1Medtr5g055350.1Medtr5g010370.1
Medtr5g010350.1Medtr5g095940.1Medtr1g102430.1Medtr3g007840.1Medtr5g095950.1
Mimulus guttatusmgv1a025815mmgv1a025992mmgv1a006271mmgv1a023797mmgv1a021582m
mgv1a007352mmgv1a004562m
Oryza sativaLOC_Os03g05110.1LOC_Os10g32170.1LOC_Os03g05060.2LOC_Os03g05060.1LOC_Os03g05070.1
LOC_Os12g38450.1LOC_Os10g32160.1LOC_Os10g32080.1LOC_Os10g40559.1LOC_Os06g23420.2
LOC_Os06g23420.1LOC_Os04g48480.1LOC_Os10g32110.1LOC_Os12g12290.1
Panicum virgatumPavirv00052911mPavirv00016514mPavirv00047043mPavirv00048669mPavirv00034812m
Pavirv00004154mPavirv00053716mPavirv00013474mPavirv00004155mPavirv00005480m
Pavirv00064113mPavirv00040881mPavirv00057287mPavirv00002639mPavirv00049145m
Pavirv00052250mPavirv00050116mPavirv00058137mPavirv00027041mPavirv00013287m
Pavirv00004398mPavirv00043727mPavirv00065473mPavirv00037613mPavirv00043360m
Pavirv00010825mPavirv00004150mPavirv00045520mPavirv00002799m
Physcomitrella patensPp1s5_379V6.1Pp1s158_189V6.1Pp1s47_268V6.1Pp1s60_282V6.1Pp1s5_370V6.1
Pp1s88_148V6.1Pp1s530_2V6.1Pp1s530_5V6.1Pp1s81_221V6.1Pp1s36_237V6.1
Pp1s21_30V6.1Pp1s1_428V6.1Pp1s26_8V6.1Pp1s236_30V6.1Pp1s20_115V6.1
Pp1s512_4V6.1Pp1s3_407V6.2Pp1s3_407V6.1Pp1s1_374V6.1
Phaseolus vulgarisPhvul.007G153600.1Phvul.001G266100.1Phvul.003G104800.2Phvul.003G104800.1Phvul.007G063500.1
Phvul.008G017900.1Phvul.002G157100.1Phvul.003G006800.1Phvul.001G165300.1
Picea abiesMA_10434404g0030MA_9990400g0010MA_371148g0010MA_372623g0010MA_100374g0010
MA_290104g0010MA_73539g0010MA_13968g0020MA_96103g0010MA_5948g0010
MA_76602g0010.250.389MA_76602g0010.250.389MA_10435411g0010MA_28102g0010.178.308MA_28102g0010.178.308
MA_7543346g0010
Populus trichocarpaPotri.002G256200.2Potri.002G256200.1Potri.001G120800.1Potri.014G147800.1Potri.009G032500.1
Potri.001G105300.1Potri.001G321000.1Potri.012G130700.1Potri.015G132600.1Potri.001G382200.1
Potri.001G381900.1Potri.003G112200.1Potri.003G126000.1
Prunus persicappa002811mppa005908mppa024321mppa016857mppa018367m
ppa018375mppa004844mppa006308mppa007371mppa007598m
ppa003851mppa004838mppa017713mppa008689mppa017934m
ppa025271m
Ricinus communis30190.m01120329002.m00014928455.m00036930065.m00113829637.m000730
30065.m00114130147.m01416130065.m00113628223.m000097
Setaria italicaSi034744mSi038964mSi035153mSi039422mSi038531m
Si039200mSi025042mSi039123mSi039377mSi019878m
Si012021mSi035637mSi036091mSi024608mSi008588m
Si004223m
Selaginella moellendorffii1012371181338576912679964314
126225123197983663817126870
Sorghum bicolorSb01g020070.1Sb01g047270.1Sb01g020080.1Sb01g047290.1Sb01g020060.1
Sb01g047300.1Sb08g018880.1Sb01g047280.1Sb01g047310.1Sb06g026020.1
Sb06g026010.1Sb01g047315.1Sb01g050380.1Sb01g029520.1Sb08g007160.1
Thellungiella halophilaThhalv10001932mThhalv10016337mThhalv10017561mThhalv10017898mThhalv10024922m
Thhalv10016613mThhalv10025220mThhalv10028137mThhalv10005582mThhalv10027680m
Thhalv10018517mThhalv10023358m
Vitis viniferaGSVIVT01019767001GSVIVT01031644001GSVIVT01028435001GSVIVT01004778001GSVIVT01001277001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)