y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g03760.1
FamilyGT21
Protein PropertiesLength: 520 Molecular Weight: 58588.7 Isoelectric Point: 7.5361
ChromosomeChromosome/Scaffold: 08 Start: 2680366 End: 2686877
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT21813079.6e-35
  PRVTVIMPLKGFGEHNLHNWRSQITSLYGGPIEFLFVVESTEDPAYHAVSRLIAEFEDHVEAKVVVAGLSTTCSQKIHNQLVGVETMHKDSKYVLFLDDD
  VRLHPGSIGALTREMEKTPEIFIQTGYPLDLPSGSLGSYCIYEYHMPCSMGFATGGKTFFLWGGCMMMHADDFRQDRYGVVSGLKDGGYSDDMTLAAISG
  AHKRLITSPPVAVFPHPLASDLNFGRY
Full Sequence
Protein Sequence     Length: 520     Download
MSSLDLLLFS LSRAFCSPIA VFFQIQGCLI CLTLALGWAC AAYVRNREIK QMKDCMKNGN    60
SFSFLCHDIN ELEHSYQVDL PRVTVIMPLK GFGEHNLHNW RSQITSLYGG PIEFLFVVES    120
TEDPAYHAVS RLIAEFEDHV EAKVVVAGLS TTCSQKIHNQ LVGVETMHKD SKYVLFLDDD    180
VRLHPGSIGA LTREMEKTPE IFIQTGYPLD LPSGSLGSYC IYEYHMPCSM GFATGGKTFF    240
LWGGCMMMHA DDFRQDRYGV VSGLKDGGYS DDMTLAAISG AHKRLITSPP VAVFPHPLAS    300
DLNFGRYWNY LRKQTFVLES YLTNVNWVMN RALFTTHCYL SWGFVAPYFM AMIHVAAALR    360
FYYKGFSPEE IAYTSGGLSL VTFLAICTLV ELLSMWNLTR IEVQLCNMLS PEAPQLSLAS    420
YNWCLVFIAM LVDNFLYPVS AFRSHFSQSI NWSGIRYYLK DGKISKIERT PRSKDMGPVF    480
TDLGGKHLYG KKGLPTRGSF LSSLSRSLAQ WHQPKKFDN*                          540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03472HpnI8.0e-681197117+
pfam13641Glyco_tranf_2_31.0e-681254181+
COG1215COG12151.0e-878396334+
cd02520Glucosylceramide_synthase9.0e-1081312237+
pfam13506Glyco_transf_216.0e-12139312178+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK73021.1015185519AF367245_1 ceramide glucosyltransferase [Gossypium arboreum]
GenBankABK95617.1035184516unknown [Populus trichocarpa]
RefSeqNP_565460.1015184518ceramide glucosyltransferase, putative [Arabidopsis thaliana]
RefSeqXP_002329645.10751811523predicted protein [Populus trichocarpa]
RefSeqXP_002514215.1035199522ceramide glucosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
sphingolipid biosynthesis (plants)RXN-7793EC-2.4.1.80ceramide glucosyltransferase
Transmembrane Domains
StartEnd
2042
339361
371393
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6984232891214090
DT4744412851744580
DV125113265923560
DT7651012791023800
EL441917271453150
Orthologous Group
SpeciesID
Arabidopsis lyrata319569
Arabidopsis thalianaAT2G19880.1AT2G19880.2
Brachypodium distachyonBradi2g58060.1
Brassica rapaBra036698Bra039028Bra031106
Carica papayaevm.model.supercontig_40.95
Capsella rubellaCarubv10013384m
Citrus clementinaCiclev10008006m
Citrus sinensisorange1.1g010062m
Cucumis sativusCucsa.288830.1
Eucalyptus grandisEucgr.C03729.1
Fragaria vescamrna11297.1-v1.0-hybrid
Glycine maxGlyma01g01130.1Glyma05g35860.2Glyma16g08510.1
Gossypium raimondiiGorai.010G077100.1Gorai.010G077100.2Gorai.009G027500.1Gorai.009G027500.2
Linum usitatissimumLus10034973
Malus domesticaMDP0000289917MDP0000035240MDP0000126193
Manihot esculentacassava4.1_005602mcassava4.1_007721m
Medicago truncatulaMedtr8g102490.1Medtr8g102500.1
Mimulus guttatusmgv1a004497mmgv1a004580m
Oryza sativaLOC_Os01g67870.1
Panicum virgatumPavirv00019095mPavirv00063321m
Physcomitrella patensPp1s194_131V6.1
Phaseolus vulgarisPhvul.004G176200.1Phvul.002G308700.1
Populus trichocarpaPotri.018G087700.3Potri.018G087700.2Potri.018G087700.1Potri.006G164800.2Potri.T063300.1
Potri.006G164800.1
Prunus persicappa004285mppa005382m
Ricinus communis29912.m005431
Setaria italicaSi001058m
Selaginella moellendorffii74622
Sorghum bicolorSb03g043150.1
Thellungiella halophilaThhalv10001962m
Vitis viniferaGSVIVT01015303001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny