y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g05420.2
FamilyGT28
Protein PropertiesLength: 330 Molecular Weight: 35195.1 Isoelectric Point: 5.8813
ChromosomeChromosome/Scaffold: 08 Start: 3862396 End: 3867260
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT281853275.9e-35
  SKATAMSHFFPDSGLYVIWQTGVEAFDEMDSLVKTHPRLYITPFMHCMDLAYAAADLIVSRAGAMTCYEISATGKPSILIPSPNFSEGNQFRNASLMADV
  AGVTVITEDELDSSTLAIAIEKIGDKKMEDMSERALKAANPNA
Full Sequence
Protein Sequence     Length: 330     Download
RVSISCHSSP SNSNNDPIRV AFSGDGTGSN VYPALAIAEE LKTANPTCQF LFLGTPNSVE    60
SAAISSAGYD FASVSSPPQN LVFFPQRLLK SLIQCLCHLR DFQPHVVVGT GGYVSFPACI    120
AAKLRGGTNV VIHEPNSVPG FANSLLSFLA DAIFVAFNST LDSFPRNKCL VCGNPVRLSI    180
RNLVSKATAM SHFFPDSGLY VIWQTGVEAF DEMDSLVKTH PRLYITPFMH CMDLAYAAAD    240
LIVSRAGAMT CYEISATGKP SILIPSPNFS EGNQFRNASL MADVAGVTVI TEDELDSSTL    300
AIAIEKIGDK KMEDMSERAL KAANPNASP*                                     360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK12446PRK124469.0e-2619311327+
COG0707MurG9.0e-6518327345+
TIGR01133murG9.0e-7118328348+
PRK00726murG6.0e-9119328345+
cd03785GT1_MurG1.0e-10019328347+
Gene Ontology
GO TermDescription
GO:0005975carbohydrate metabolic process
GO:0016758transferase activity, transferring hexosyl groups
GO:0030246carbohydrate binding
GO:0030259lipid glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI15500.10732847418unnamed protein product [Vitis vinifera]
RefSeqNP_177515.10731843405glycosyl transferase family 28 protein [Arabidopsis thaliana]
RefSeqXP_002277203.10732842413PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317900.101032824386predicted protein [Populus trichocarpa]
RefSeqXP_002524882.10632843419UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2u_A3e-32203285344A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_B3e-29193288343A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1nlm_A3e-29193288343A Chain A, Crystal Structure Of The Pseudomonas Aeruginosa Murg:udp-glcnac Substrate Comp
PDB1f0k_B3e-29193288343A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
PDB1f0k_A3e-29193288343A Chain A, The 1.9 Angstrom Crystal Structure Of E. Coli Murg
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES821435335162990
CO115843274993280
DW243293288282640
CO0939912591143280
ES821129281302590
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01253.1
Arabidopsis lyrata316317
Arabidopsis thalianaAT1G73740.1
Brachypodium distachyonBradi2g13780.1
Brassica rapaBra015969
Carica papayaevm.model.supercontig_3.458
Capsella rubellaCarubv10022300m
Chlamydomonas reinhardtiiCre12.g527950.t1.3
Citrus clementinaCiclev10020201m
Citrus sinensisorange1.1g031484m
Cucumis sativusCucsa.121750.1
Eucalyptus grandisEucgr.K02237.1
Fragaria vescamrna09449.1-v1.0-hybrid
Glycine maxGlyma05g34250.2Glyma05g34250.3
Gossypium raimondiiGorai.001G067900.3Gorai.001G067900.1
Malus domesticaMDP0000880838MDP0000170708
Manihot esculentacassava4.1_029849m
Oryza sativaLOC_Os01g33230.1
Physcomitrella patensPp1s21_151V6.1
Phaseolus vulgarisPhvul.002G325300.1
Picea abiesMA_159099g0140
Populus trichocarpaPotri.012G053600.1
Prunus persicappa005855m
Ricinus communis29747.m00107734442.m000027
Setaria italicaSi001498m
Selaginella moellendorffii123054121052
Sorghum bicolorSb03g015470.1
Thellungiella halophilaThhalv10018574mThhalv10018576m
Vitis viniferaGSVIVT01008345001
Volvox carteriVocar20003855m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny