y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g07291.1
FamilyGT14
Protein PropertiesLength: 202 Molecular Weight: 22445.9 Isoelectric Point: 7.1603
ChromosomeChromosome/Scaffold: 08 Start: 5251735 End: 5252471
DescriptionCore-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT14642000
  LAYLVSGSKGDGAAVTRVLLALYHPNNRYVVHLDLESSPEERSDLVRFVEGHALFKRFGNVRVIKKANLVTYRGPTMVANTLHAATILLRELGDWDWFIN
  LSASDYPLVTQDDLLHTFSYLPRDLNFIDHTSDIGWK
Full Sequence
Protein Sequence     Length: 202     Download
MTLLLGLTKI CSLFLLFLAT LTSPEGTPIL PFYRSITAAS YSVFVESKLR PLPVVSSLPP    60
PPSLAYLVSG SKGDGAAVTR VLLALYHPNN RYVVHLDLES SPEERSDLVR FVEGHALFKR    120
FGNVRVIKKA NLVTYRGPTM VANTLHAATI LLRELGDWDW FINLSASDYP LVTQDDLLHT    180
FSYLPRDLNF IDHTSDIGWK E*                                             240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02485Branch5.0e-4370201132+
PLN03183PLN031834.0e-7070201132+
Gene Ontology
GO TermDescription
GO:0008375acetylglucosaminyltransferase activity
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_197009.10320124225glycosyltransferase family 14 protein / core-2/I-branching enzyme family protein [Arabidopsis thaliana]
RefSeqXP_002282083.102220142219PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305329.102220142219predicted protein [Populus trichocarpa]
RefSeqXP_002324028.104520164219predicted protein [Populus trichocarpa]
RefSeqXP_002517446.102520147221acetylglucosaminyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3otk_D0.00000780178101193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_C0.00000780178101193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_B0.00000780178101193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3otk_A0.00000780178101193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB2gam_D0.0000280178101193A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FS340995178242010
DC654031181242010
JG725626177242000
HS251405179242010
HS006183179242010
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_036_00138.1Aquca_033_00106.2Aquca_033_00106.1Aquca_002_00424.1Aquca_020_00132.1
Aquca_008_00038.1Aquca_010_00740.1Aquca_009_00543.1Aquca_009_00543.2Aquca_041_00146.1
Aquca_002_01158.1Aquca_034_00186.1Aquca_018_00050.1Aquca_002_01158.2
Arabidopsis lyrata478965492046474430488347887505
352501493988317250476239479931
345499
Arabidopsis thalianaAT3G15350.2AT3G15350.1AT4G27480.2AT4G27480.1AT1G53100.2
AT1G53100.1AT5G15050.1AT4G03340.1AT1G03520.2AT1G03520.1
AT5G39990.1AT3G03690.1AT2G37585.1AT1G71070.1AT3G24040.1
Brachypodium distachyonBradi2g06240.1Bradi1g36660.1Bradi4g00410.1Bradi3g14860.1Bradi1g12030.1
Bradi3g27240.1Bradi1g66497.1Bradi2g35570.1Bradi1g75410.1Bradi2g01620.1
Bradi2g51360.1
Brassica rapaBra027260Bra021099Bra010402Bra019047Bra023502
Bra033408Bra025627Bra000835Bra019015Bra005182
Bra007960Bra003937Bra016161Bra036442Bra028365
Bra030961.71.182Bra030961.71.182Bra028449.89.200Bra028449.89.200Bra030961.183.259
Bra030961.183.259Bra028449.201.280Bra028449.201.280Bra026345
Carica papayaevm.model.supercontig_80.66evm.model.supercontig_14.55evm.model.supercontig_75.39evm.model.supercontig_34.110evm.model.supercontig_161.40
evm.model.supercontig_65.120evm.model.supercontig_1305.1evm.model.supercontig_59.74
Capsella rubellaCarubv10015665mCarubv10004902mCarubv10011618mCarubv10000991mCarubv10007491m
Carubv10009126mCarubv10000946mCarubv10000945mCarubv10015869mCarubv10023410m
Carubv10021335mCarubv10013765m
Citrus clementinaCiclev10008457mCiclev10008455mCiclev10008397mCiclev10011781mCiclev10015218m
Ciclev10012121mCiclev10020438mCiclev10015512mCiclev10015447mCiclev10004926m
Ciclev10004962mCiclev10027025mCiclev10005424m
Citrus sinensisorange1.1g015112morange1.1g015070morange1.1g014438morange1.1g037238morange1.1g013052m
orange1.1g015219morange1.1g015651morange1.1g015902morange1.1g015224morange1.1g039162m
orange1.1g016354morange1.1g012284morange1.1g014248m
Cucumis sativusCucsa.123130.1Cucsa.032560.2Cucsa.032560.1Cucsa.339150.1Cucsa.132030.1
Cucsa.147940.1Cucsa.175380.1Cucsa.069780.1Cucsa.074790.1Cucsa.283010.1
Cucsa.256110.1
Eucalyptus grandisEucgr.J02142.1Eucgr.C04217.1Eucgr.K00938.1Eucgr.A02143.1Eucgr.A02896.1
Eucgr.A01787.1Eucgr.G02200.1Eucgr.F01131.1.87.200Eucgr.F01131.1.87.200Eucgr.F01131.1.201.312
Eucgr.F01131.1.201.312Eucgr.H00106.1
Fragaria vescamrna17150.1-v1.0-hybridmrna01296.1-v1.0-hybridmrna31025.1-v1.0-hybridmrna10276.1-v1.0-hybridmrna18171.1-v1.0-hybrid
mrna18381.1-v1.0-hybridmrna20759.1-v1.0-hybridmrna05266.1-v1.0-hybridmrna01567.1-v1.0-hybrid
Glycine maxGlyma13g35180.2Glyma13g35180.1Glyma12g35330.1Glyma06g36720.1Glyma12g25250.1
Glyma13g23660.1Glyma17g12400.1Glyma06g29710.1Glyma13g05020.1Glyma04g18960.1
Glyma18g48990.1Glyma06g45200.2Glyma06g45200.1Glyma12g11780.1Glyma13g05020.2
Glyma19g02215.1Glyma18g28140.1Glyma16g03980.1Glyma19g29570.1Glyma03g19720.2
Glyma09g15890.1Glyma20g26180.1Glyma10g41085.1Glyma07g23470.1Glyma20g04810.1
Glyma09g21230.1Glyma10g25500.1Glyma12g12626.1Glyma09g37630.3Glyma07g02330.1
Glyma08g23690.2
Gossypium raimondiiGorai.007G323000.1Gorai.013G168800.1Gorai.002G069800.1Gorai.004G277100.1Gorai.006G025900.1
Gorai.007G078400.1Gorai.008G152300.1Gorai.002G017200.1Gorai.007G254100.1Gorai.007G375700.1
Gorai.006G025900.2Gorai.013G168800.2Gorai.002G180500.1Gorai.005G162900.1Gorai.005G039100.1
Gorai.011G162900.2Gorai.011G096300.1Gorai.011G162900.1Gorai.011G003300.1Gorai.011G003300.3
Gorai.013G168800.3Gorai.011G003300.2Gorai.011G162900.4Gorai.011G162900.3Gorai.011G096200.1
Gorai.012G103300.1Gorai.011G003300.4.64.175Gorai.011G003300.4.64.175Gorai.011G003300.4.176.237Gorai.011G003300.4.176.237
Linum usitatissimumLus10019477Lus10043324Lus10014495Lus10032189Lus10030084
Lus10001076Lus10033714Lus10031626Lus10020316Lus10005676
Lus10025339Lus10024404Lus10023687Lus10010887Lus10011765
Lus10012710Lus10033379Lus10034829Lus10032190
Malus domesticaMDP0000239687MDP0000123687MDP0000155219MDP0000282003MDP0000162834
MDP0000249209MDP0000449744MDP0000307454MDP0000267752MDP0000932170
MDP0000245544MDP0000137993MDP0000885638MDP0000270038MDP0000153023
MDP0000192952.75.186MDP0000192952.75.186MDP0000142975MDP0000272624MDP0000295443.72.183
MDP0000295443.72.183MDP0000192952.187.266MDP0000192952.187.266MDP0000295443.184.263MDP0000295443.184.263
MDP0000181360MDP0000715754MDP0000313248MDP0000313224.50.161MDP0000313224.50.161
MDP0000316002.50.161MDP0000316002.50.161MDP0000313224.162.242MDP0000313224.162.242MDP0000316002.162.241
MDP0000316002.162.241
Manihot esculentacassava4.1_021997mcassava4.1_008494mcassava4.1_008168mcassava4.1_008154mcassava4.1_008155m
cassava4.1_007790mcassava4.1_009031mcassava4.1_009098mcassava4.1_009176mcassava4.1_008034m
cassava4.1_009261mcassava4.1_009439mcassava4.1_022088m
Medicago truncatulaMedtr2g085300.1Medtr4g114140.1Medtr4g022240.1Medtr4g114380.1Medtr7g086720.1
Medtr1g108280.1Medtr6g011080.1
Mimulus guttatusmgv1a008702mmgv1a008696mmgv1a006985mmgv1a006718mmgv1a006669m
mgv1a022320mmgv1a009678mmgv1a007531mmgv1a006803mmgv1a011716m
Oryza sativaLOC_Os01g10440.1LOC_Os06g40060.1LOC_Os12g44240.1LOC_Os08g04790.1LOC_Os03g48560.1
LOC_Os10g30080.1LOC_Os03g16890.1LOC_Os01g03160.2LOC_Os01g03160.1LOC_Os04g23580.1
LOC_Os05g06050.1LOC_Os01g56570.1LOC_Os06g40060.2
Panicum virgatumPavirv00019455mPavirv00024205mPavirv00070373mPavirv00011279mPavirv00012576m
Pavirv00006497mPavirv00040685mPavirv00045020mPavirv00027503mPavirv00007501m
Pavirv00030167mPavirv00018830mPavirv00063237mPavirv00032862mPavirv00034423m
Pavirv00063189mPavirv00055573mPavirv00024965mPavirv00004851mPavirv00030168m
Pavirv00001113mPavirv00066444mPavirv00018457mPavirv00041877mPavirv00067372m
Physcomitrella patensPp1s338_21V6.1Pp1s329_26V6.1Pp1s245_39V6.1Pp1s170_74V6.1Pp1s90_77V6.1
Pp1s149_88V6.1
Phaseolus vulgarisPhvul.011G158600.1Phvul.005G071700.2Phvul.005G071700.1Phvul.003G164200.1Phvul.004G025100.1
Phvul.009G197600.1Phvul.011G112200.1Phvul.010G014000.1Phvul.001G105800.1Phvul.004G049700.1
Phvul.008G044300.1Phvul.007G037400.1Phvul.003G022600.1Phvul.008G044300.2Phvul.007G237800.1
Phvul.008G254300.1Phvul.008G030600.1
Picea abiesMA_15991g0010MA_10434286g0010MA_135415g0010MA_10270737g0010MA_9468439g0010
MA_765295g0010MA_10435892g0010MA_56251g0010MA_10236057g0010
Populus trichocarpaPotri.011G119600.3Potri.011G119600.2Potri.011G119600.1Potri.001G399500.2Potri.001G399500.1
Potri.004G130300.1Potri.017G075600.1Potri.013G145500.3Potri.013G145500.2Potri.013G145500.1
Potri.009G003300.1Potri.019G104600.2Potri.019G104600.1Potri.013G066200.2Potri.013G066200.1
Potri.006G263000.1Potri.008G128000.1Potri.010G114800.3Potri.010G114800.2Potri.008G128000.2
Potri.010G114800.1Potri.001G053800.1Potri.010G114800.4Potri.008G006500.1Potri.008G128000.3
Prunus persicappa006234mppa006230mppa006279mppa006088mppa005952m
ppa007142mppa006588mppa006761mppa006063mppa006304m
Ricinus communis27755.m00008729822.m00344929983.m00325630025.m00058230059.m000467
29904.m00301530072.m00093528320.m00112230186.m001300
Setaria italicaSi001156mSi006450mSi013663mSi035659mSi022126m
Si040241mSi035899mSi035846mSi010215mSi022136m
Si001619mSi002524mSi002523m
Selaginella moellendorffii8393274856
Sorghum bicolorSb03g002590.1Sb03g002600.1Sb10g023480.1Sb08g023170.1Sb01g011480.1
Sb01g021260.1Sb01g047240.1Sb01g039410.1Sb03g007750.1Sb07g003140.1
Sb09g004030.1Sb03g035990.1
Thellungiella halophilaThhalv10020797mThhalv10025300mThhalv10012067mThhalv10012246mThhalv10012228m
Thhalv10013590mThhalv10027776mThhalv10028669mThhalv10020953mThhalv10016783m
Thhalv10002511m
Vitis viniferaGSVIVT01014331001GSVIVT01015525001GSVIVT01020106001GSVIVT01030572001GSVIVT01011780001
GSVIVT01034191001GSVIVT01032590001GSVIVT01029033001GSVIVT01029965001GSVIVT01016621001
Zea maysAC208327.4_FGT006
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)