y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g09360.1
FamilyGT77
Protein PropertiesLength: 357 Molecular Weight: 40206.7 Isoelectric Point: 9.3584
ChromosomeChromosome/Scaffold: 08 Start: 6689297 End: 6692828
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771203360
  DMVLVIAEDYASLDRVNLLWPGHAVLIPPVLDAEAAHKFGSQGFFNFTARRPSHLLKILELGYSVMYNDVDMVWLADPFPYLQGNHDVYFTDDMTAIKPL
  NHSHDLPPPGKKGRPYICSCMIFLRPTNGAKLILRKWIEELQIQPWSKTVKSNDQPAFNWALMKNAKEVDLYLLPQAAFPTGGLYFKNKAWVKETKGMHV
  IIHNNYIVGFEKKIKRF
Full Sequence
Protein Sequence     Length: 357     Download
MSSFLHQRSS LQNPFSNPFP ASTPSSSNSK KSLSIMGPTT LLALISLIVI LGVFCPWVGF    60
PQGFPFTPTP TSKWAHYTLE QALSFVAKNG SSVIVCIVSQ PYLPFLNNWL ISISMQKRQD    120
MVLVIAEDYA SLDRVNLLWP GHAVLIPPVL DAEAAHKFGS QGFFNFTARR PSHLLKILEL    180
GYSVMYNDVD MVWLADPFPY LQGNHDVYFT DDMTAIKPLN HSHDLPPPGK KGRPYICSCM    240
IFLRPTNGAK LILRKWIEEL QIQPWSKTVK SNDQPAFNWA LMKNAKEVDL YLLPQAAFPT    300
GGLYFKNKAW VKETKGMHVI IHNNYIVGFE KKIKRFRDYG LWLVDDHAHE SPLGGL*       360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans1.0e-38122336220+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAZ94713.106935671357putative alpha 1,3-xylosyltransferase [Linum usitatissimum]
EMBLCAN69309.10483561309hypothetical protein [Vitis vinifera]
RefSeqXP_002273155.101635620360PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002279469.107135677361PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511939.1013561356conserved hypothetical protein [Ricinus communis]
Transmembrane Domains
StartEnd
3860
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY264723263723340
FC914138254723250
DY294483264723350
EE1064442191393570
DY264723243293520.56
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_074_00044.1
Arabidopsis lyrata352664892838490401474813912111
Arabidopsis thalianaAT4G01220.1AT1G56550.1AT4G01750.1AT4G01220.2AT4G01770.1
Brachypodium distachyonBradi2g26850.1
Brassica rapaBra035432Bra036306Bra000906Bra039864Bra017900
Bra037377Bra000950Bra035431Bra000907
Carica papayaevm.model.supercontig_184.13
Capsella rubellaCarubv10001259mCarubv10001249mCarubv10021691m
Citrus clementinaCiclev10020808mCiclev10022071mCiclev10021218m
Citrus sinensisorange1.1g018302morange1.1g027009morange1.1g021054m
Cucumis sativusCucsa.135840.2Cucsa.135840.1
Eucalyptus grandisEucgr.E00084.1
Fragaria vescamrna09360.1-v1.0-hybrid
Gossypium raimondiiGorai.004G154200.4Gorai.007G104400.1Gorai.004G154200.1Gorai.004G154200.5Gorai.004G154200.3
Gorai.004G154200.2
Linum usitatissimumLus10002153Lus10012650Lus10008735
Malus domesticaMDP0000150593MDP0000264889
Manihot esculentacassava4.1_010616mcassava4.1_010633m
Mimulus guttatusmgv1a008876m
Oryza sativaLOC_Os05g32120.1
Panicum virgatumPavirv00063401mPavirv00048789m
Physcomitrella patensPp1s19_296V6.1
Phaseolus vulgarisPhvul.002G188500.1
Picea abiesMA_10233136g0010MA_173768g0010
Populus trichocarpaPotri.014G092400.2Potri.002G166000.1Potri.014G092400.1
Prunus persicappa007793m
Ricinus communis30174.m008682
Setaria italicaSi022588mSi017632m
Selaginella moellendorffii87970
Sorghum bicolorSb09g019070.1
Thellungiella halophilaThhalv10029467mThhalv10015591mThhalv10024021mThhalv10024115mThhalv10028748m
Vitis viniferaGSVIVT01016220001GSVIVT01027019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny