y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g13400.1
FamilyGT24
Protein PropertiesLength: 1628 Molecular Weight: 185189 Isoelectric Point: 6.038
ChromosomeChromosome/Scaffold: 08 Start: 9802914 End: 9827310
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT24132115680
  INIFSIASGHLYERFMKIMILSVLKNTHRPVKFWFIKNYLSPPFKDLIPHMALEYGFEYELVTYKWPTWLHKQKEKQRRIWAYKILFLDVIFPLSLEKVI
  FVDADQVVRADMGVLYDMDIRGKPLAYTPFCDNNKEMDGYRFWRQGFWKDHLRGKPYHISALYVVDLKKFRETAAGDNLRVIYETLSKDPNSLANLDQDL
  PNYAQHTVPIFSLPQEWLWCESWCGNATKYKAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1628     Download
MGCLWRSRCR VLIVFMLLNI GSAFADTPQR PKNVQTSLRA KWSGTPLLLE AGELLSNEKK    60
DLFWDFIEIW LNTEKDAVSS RTAKDCLKKI LECGRPLLRE PLKSLFELSL MLRSASPRLV    120
LYQQLAEESL TSFPLGDENY SDNETEEKLQ TEKKIERRKV DPLHGVILKS HGGKCCWVDT    180
GEHLFLDFYE LLAWLQDSAE QVGDSFQRPE IFDFDHVYYE LSVGSPVAIL YGAIGTNCFK    240
EFHVALVKAA KEGKVKYVVR PVLPAGCELN INHCGSVGAG ESVNLGGYGV ELALKNMEYK    300
AMDDSTVKKG VTLEDPRTED LSQEVRGFIF SKILVRKPEL ASEVMAFRDY LLSSTVSDTL    360
DVWELKDLGH QTVQRIVRAS DPLQSMQEIN QNFPSVVSSL SRMKLEDSVR DEIMANQRMV    420
PPGKSLMALN GALVNVEDVD LYLLFDLIHQ DLLLADQFSK LKIPQGTLKK LLSTSPPSES    480
SIPRVDFRSS HVHYLNNLEE DAKYKQWRNN LDEILMPVFP GQLRYIRKNL FHAVFVLDPA    540
TRCGLESIDM IISLYENDFP VRFGIVLYSS KFVTQLENHA TKEHSDEDIS TMIICLFSYI    600
NENYGAEMAY QFLRNVNKLH IESDGDADEA LETHHVEGVF VETILSKVKS PPQEILLKLY    660
KDQKLKELSQ ESSKFVFKLG LSKLQCSFLM NGLIIDPTEE ALIDALSDET QRIQEQVYYG    720
QMMSDTDVLA KFLSEAGIQR YNPKIISDSK PRFIPLSMFT LGEESVLNDI VYLHSPGTID    780
DTKAVTHLLA VDITSRNGMK LLQQGIHYLI EGSKNARVGL LFNANPSPNL FSLLFVKVFE    840
ITASLYSHKT NVLDFLDQLC SLYEKNYILS PAMEAESTEA FVDMVCELSK ANGLPSKGYR    900
FALPEFPAGE VRKHFTKVQN SLYRVLGLES GVNAVFTNGR VTYPIDKSTF LTADLHLLES    960
IEFKQRTKHI VEIIEEVEWR DVDPDTITSK FISDIVMALS SSMAKRDRNS ESARFEILND    1020
QHSAIILNNE NSSIHIDAVL DPLSPTSQRL SGILRVLWKY IQPSMRIVLN PVSSLADLPL    1080
KSYYRYVVPT MDDFSNTDSA INGPKAFFAN MPLSKTLTMN LDVPESWLVE PVIAFHDLDN    1140
ILLENLGNTR TLQAVFELEA LVLTGHFSEK DHDPPRGLQL ILGTKTTPHL VDTLVMDNLG    1200
YWQMKVSPGV WYLQLAPGRS SELYILKEDS EGNYDKKSSK LITINDFRGK VFHMEVVKKK    1260
GKEHEKLLLL DDNAQDNKKG SGLNSNFLKW ASGFIGSNKS SKKAEKSPQE KGKGGRHGKT    1320
INIFSIASGH LYERFMKIMI LSVLKNTHRP VKFWFIKNYL SPPFKDLIPH MALEYGFEYE    1380
LVTYKWPTWL HKQKEKQRRI WAYKILFLDV IFPLSLEKVI FVDADQVVRA DMGVLYDMDI    1440
RGKPLAYTPF CDNNKEMDGY RFWRQGFWKD HLRGKPYHIS ALYVVDLKKF RETAAGDNLR    1500
VIYETLSKDP NSLANLDQDL PNYAQHTVPI FSLPQEWLWC ESWCGNATKY KAKTIDLCNN    1560
PMTKEPKLQG ARRIVSEWPD LDFEARRFTA RILGDDQESE SIQPPNQSKD LNSEGSSNED    1620
RESRAEL*                                                             1680
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01501Glyco_transf_80.000113401520190+
cd04194GT8_A4GalT_like2.0e-1213211537229+
cd00505Glyco_transf_87.0e-5313211568257+
pfam06427UDP-g_GGTase7.0e-769931198212+
cd06432GT8_HUGT1_C_like9.0e-17013211568248+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.101162711674AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
RefSeqNP_177278.301162711613EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.101162711611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002454743.10291627371564hypothetical protein SORBIDRAFT_04g036540 [Sorghum bicolor]
RefSeqXP_002529534.101151811499UDP-glucose glycoprotein:glucosyltransferase, putative [Ricinus communis]
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO415354583106416280
HO797114359127116280
GO883503329128216080
DR944618278131415910
HO41535415990810651e-19
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma20g20260.1Glyma05g30230.1Glyma08g20020.1Glyma08g20020.2
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny