y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g14730.1
FamilyAA1
Protein PropertiesLength: 577 Molecular Weight: 64852.6 Isoelectric Point: 8.0622
ChromosomeChromosome/Scaffold: 08 Start: 10724343 End: 10727358
DescriptionCupredoxin superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA13495524.48416e-44
  RLAQSFSIKARQGYIHKPPTTSDRVIVLLNTQNNISEYRHWSVNNVSFTLPHTPYLIALKENINGAFDSTPPPDGYDFANYDIFSVASNANATSSSGIYR
  LKFNTTVDIILQNANTMTKTNSETHPWHLHGHDFWVLGYGKGKFDVNNDTKKYNLENPIMKNTVPVHPFGWTALRFRTDNPGVWAFHCHIESHFYMGMGV
  VFEE
AA1903520
  LSIHWHGIRQIGTPWFDGTEGVTQCPILPGDTFIYQFVVDRPGTYLYHAHYGIQREAGLYGMMRVAPRDPEPFAYDLDRSIILNDWYHSSTYEQAAGLSS
  IPFRWVGEPQSLLIHGKGIFNCSKSPSLGTDVCDASKCSPFVQTVIPGKTYRLRIASLTALSALSFQIEGHNMTVVEADGHYVEPFVVKNLFIYSGETYS
  VTVKSDQDPSRNYWITSNVVSRNRSTPAGLGMFNYYPNHPKRSPPTVPPSPPAWHDVEPRLAQ
Full Sequence
Protein Sequence     Length: 577     Download
MVELGLISLR ALQLPRLLIL CFFVILGNFH KAEARIRHYK WEAKYEFRSP DCFKKLVITI    60
NGKTPGPSIQ AQEGDTIIVQ VNNSLVTENL SIHWHGIRQI GTPWFDGTEG VTQCPILPGD    120
TFIYQFVVDR PGTYLYHAHY GIQREAGLYG MMRVAPRDPE PFAYDLDRSI ILNDWYHSST    180
YEQAAGLSSI PFRWVGEPQS LLIHGKGIFN CSKSPSLGTD VCDASKCSPF VQTVIPGKTY    240
RLRIASLTAL SALSFQIEGH NMTVVEADGH YVEPFVVKNL FIYSGETYSV TVKSDQDPSR    300
NYWITSNVVS RNRSTPAGLG MFNYYPNHPK RSPPTVPPSP PAWHDVEPRL AQSFSIKARQ    360
GYIHKPPTTS DRVIVLLNTQ NNISEYRHWS VNNVSFTLPH TPYLIALKEN INGAFDSTPP    420
PDGYDFANYD IFSVASNANA TSSSGIYRLK FNTTVDIILQ NANTMTKTNS ETHPWHLHGH    480
DFWVLGYGKG KFDVNNDTKK YNLENPIMKN TVPVHPFGWT ALRFRTDNPG VWAFHCHIES    540
HFYMGMGVVF EEGVERVGKL PSSIMGCGQT RGFHGP*                             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR03390ascorbOXfungal5.0e-7952544528+
TIGR03389laccase4.0e-10134541538+
PLN02604PLN02604021572559+
TIGR03388ascorbase036570543+
PLN02191PLN02191024573559+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAY47050.103257631578ascorbate oxidase [Solanum lycopersicum]
DDBJBAB86897.10125761567syringolide-induced protein B13-1-1 [Glycine max]
RefSeqXP_002281435.10175756565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281497.10125751565PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306323.10165762570predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0345701541A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp.
PDB1asq_A0345701541A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp.
PDB1asp_B0345701541A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp.
PDB1asp_A0345701541A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp.
PDB1aso_B0345701541A Chain A, Native Structure Of Beta-Galactosidase From Penicillium Sp.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR847295260713280
EL420184276323030
DV7055153002455440
CK298807284232980
DV7061952922455360
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_041_00052.1.82.339Aquca_041_00052.1.82.339Aquca_014_00555.1.62.334Aquca_014_00555.1.62.334Aquca_076_00041.2
Aquca_076_00041.1Aquca_041_00052.1.322.551Aquca_041_00052.1.322.551Aquca_014_00555.1.293.531Aquca_014_00555.1.293.531
Arabidopsis lyrata327935489021.76.330489021.76.330489021.332.543489021.332.543
Arabidopsis thalianaAT4G39830.1AT5G21100.1AT5G21105.3.93.349AT5G21105.3.93.349AT5G21105.1.93.348
AT5G21105.1.93.348AT5G21105.2AT5G21105.1.351.561AT5G21105.1.351.561AT5G21105.3.351.538
AT5G21105.3.351.538
Brachypodium distachyonBradi4g28950.1.82.349Bradi4g28950.1.82.349Bradi4g34690.1.66.371Bradi4g34690.1.66.371Bradi1g37600.1.101.397
Bradi1g37600.1.101.397Bradi1g37620.1.24.213Bradi1g37620.1.24.213Bradi4g28950.1.336.556Bradi4g28950.1.336.556
Bradi1g37620.1.300.552Bradi1g37620.1.300.552Bradi1g37600.1.396.616Bradi1g37600.1.396.616Bradi4g34690.1.374.560
Bradi4g34690.1.374.560
Brassica rapaBra021239Bra002357.76.340Bra002357.76.340Bra020145.76.334Bra020145.76.334
Bra040902.79.327Bra040902.79.327Bra002355.79.329Bra002355.79.329Bra040902.333.545
Bra040902.333.545Bra002357.331.550Bra002357.331.550Bra020145.312.543Bra020145.312.543
Bra002355.333.550Bra002355.333.550Bra002356
Carica papayaevm.model.supercontig_103.59.65.327evm.model.supercontig_103.59.65.327evm.model.supercontig_103.59.329.574evm.model.supercontig_103.59.329.574
Capsella rubellaCarubv10003529mCarubv10004461mCarubv10000569m.76.336Carubv10000569m.76.336Carubv10000578m.78.329
Carubv10000578m.78.329Carubv10000578m.287.554Carubv10000578m.287.554Carubv10000569m.338.548Carubv10000569m.338.548
Chlamydomonas reinhardtiiCre01.g031500.t1.2Cre02.g098350.t1.3
Citrus clementinaCiclev10014733mCiclev10025235m.97.370Ciclev10025235m.97.370Ciclev10025235m.335.568Ciclev10025235m.335.568
Citrus sinensisorange1.1g008038morange1.1g007890m.97.371orange1.1g007890m.97.371orange1.1g012467morange1.1g013385m
orange1.1g016150morange1.1g016030morange1.1g007890m.335.568orange1.1g007890m.335.568
Cucumis sativusCucsa.142840.1Cucsa.142830.1Cucsa.104600.1.63.324Cucsa.104600.1.63.324Cucsa.142810.1.299.517
Cucsa.142810.1.299.517Cucsa.104600.1.292.531Cucsa.104600.1.292.531
Eucalyptus grandisEucgr.B03781.1Eucgr.J00632.1Eucgr.I00388.1.75.347Eucgr.I00388.1.75.347Eucgr.I00451.1.64.318
Eucgr.I00451.1.64.318Eucgr.I00386.1.71.301Eucgr.I00386.1.71.301Eucgr.G00738.1.40.302Eucgr.G00738.1.40.302
Eucgr.I00360.1Eucgr.G00745.1Eucgr.I00451.1.277.518Eucgr.I00451.1.277.518Eucgr.I00388.1.301.548
Eucgr.I00388.1.301.548Eucgr.I00383.1Eucgr.I00385.1Eucgr.I00386.1.256.483Eucgr.I00386.1.256.483
Eucgr.G00738.1.290.505Eucgr.G00738.1.290.505Eucgr.I00361.1Eucgr.I00361.2
Fragaria vescamrna18497.1-v1.0-hybridmrna31737.1-v1.0-hybridmrna11056.1-v1.0-hybridmrna11055.1-v1.0-hybridmrna00542.1-v1.0-hybrid
Glycine maxGlyma14g04530.1Glyma20g12220.1Glyma13g03650.1Glyma20g12150.1Glyma05g33470.1.88.358
Glyma05g33470.1.88.358Glyma08g14730.1.90.352Glyma08g14730.1.90.352Glyma05g33470.1.354.553Glyma05g33470.1.354.553
Glyma08g14730.1.349.552Glyma08g14730.1.349.552
Gossypium raimondiiGorai.004G227900.1Gorai.008G103600.1Gorai.003G045100.1
Linum usitatissimumLus10009603Lus10016808Lus10000871.59.334Lus10000871.59.334Lus10022504.87.341
Lus10022504.87.341Lus10026753.80.305Lus10026753.80.305Lus10025538Lus10000871.318.529
Lus10000871.318.529Lus10026753.306.552Lus10026753.306.552Lus10022504.343.558Lus10022504.343.558
Malus domesticaMDP0000179298.35.319MDP0000179298.35.319MDP0000131142.89.323MDP0000131142.89.323MDP0000459146.40.262
MDP0000459146.40.262MDP0000125288.36.266MDP0000125288.36.266MDP0000125288.374.614MDP0000125288.374.614
MDP0000179298.298.525MDP0000179298.298.525MDP0000201304MDP0000568244MDP0000131142.325.559
MDP0000131142.325.559MDP0000459146.260.495MDP0000459146.260.495MDP0000920266.221.462MDP0000920266.221.462
Manihot esculentacassava4.1_029114m.82.347cassava4.1_029114m.82.347cassava4.1_003963m.155.371cassava4.1_003963m.155.371cassava4.1_004384m.36.226
cassava4.1_004384m.36.226cassava4.1_004384m.318.564cassava4.1_004384m.318.564cassava4.1_003963m.333.583cassava4.1_003963m.333.583
cassava4.1_029114m.300.548cassava4.1_029114m.300.548
Medicago truncatulaMedtr8g091390.1.86.341Medtr8g091390.1.86.341Medtr8g091390.1.315.552Medtr8g091390.1.315.552
Mimulus guttatusmgv1a003391m.33.225mgv1a003391m.33.225mgv1a003543mmgv1a003391m.335.562mgv1a003391m.335.562
mgv1a005649m.212.451mgv1a005649m.212.451
Oryza sativaLOC_Os06g37080.1LOC_Os09g20090.1.54.408LOC_Os09g20090.1.54.408LOC_Os09g32952.1LOC_Os06g37150.1.86.374
LOC_Os06g37150.1.86.374LOC_Os06g37150.1.379.598LOC_Os06g37150.1.379.598LOC_Os09g20090.1.316.555LOC_Os09g20090.1.316.555
Panicum virgatumPavirv00010476mPavirv00034691mPavirv00008852m.57.349Pavirv00008852m.57.349Pavirv00034692m
Pavirv00038723mPavirv00009193mPavirv00052126mPavirv00008852m.333.549Pavirv00008852m.333.549
Pavirv00027786mPavirv00058661m.257.479Pavirv00058661m.257.479
Physcomitrella patensPp1s308_11V6.1Pp1s1_590V6.1Pp1s144_8V6.1Pp1s194_194V6.1Pp1s60_109V6.1.84.354
Pp1s60_109V6.1.84.354Pp1s60_109V6.1.337.558Pp1s60_109V6.1.337.558
Phaseolus vulgarisPhvul.006G011700.1Phvul.006G011600.1Phvul.002G262200.1.79.351Phvul.002G262200.1.79.351Phvul.008G206900.1
Phvul.002G262200.1.338.549Phvul.002G262200.1.338.549
Picea abiesMA_19018g0010.88.322MA_19018g0010.88.322MA_10433807g0010MA_10431339g0010MA_10436713g0030.31.219
MA_10436713g0030.31.219MA_10436713g0030.228.409MA_10436713g0030.228.409MA_10436713g0010MA_19018g0010.319.548
MA_19018g0010.319.548MA_126229g0020MA_603008g0010.263.441MA_603008g0010.263.441MA_10128792g0010
Populus trichocarpaPotri.010G171700.1Potri.009G159700.1Potri.T079500.1Potri.005G079400.1.87.361Potri.005G079400.1.87.361
Potri.T079700.1.75.347Potri.T079700.1.75.347Potri.009G159700.2Potri.001G219300.2Potri.001G454700.1.90.354
Potri.001G454700.1.90.354Potri.007G088300.1Potri.001G219300.1Potri.T079700.1.300.544Potri.T079700.1.300.544
Potri.001G454700.1.344.552Potri.001G454700.1.344.552Potri.005G079400.1.337.560Potri.005G079400.1.337.560
Prunus persicappa003375mppa003411mppa005837mppa021554m
Ricinus communis29877.m00046929708.m000190
Setaria italicaSi006138mSi032784m.54.346Si032784m.54.346Si029363m.78.344Si029363m.78.344
Si003983m.82.360Si003983m.82.360Si006071m.87.371Si006071m.87.371Si015580m
Si029363m.324.547Si029363m.324.547Si032784m.326.546Si032784m.326.546Si006071m.368.591
Si006071m.368.591Si003983m.367.550Si003983m.367.550
Selaginella moellendorffii104957.46.417104957.46.417104957.368.570104957.368.570
Sorghum bicolorSb10g022430.1Sb10g022440.1.81.467Sb10g022440.1.81.467Sb02g023150.1.78.337Sb02g023150.1.78.337
Sb02g023140.1.79.351Sb02g023140.1.79.351Sb02g023160.1.88.358Sb02g023160.1.88.358Sb03g001450.1.79.370
Sb03g001450.1.79.370Sb02g023140.1.313.549Sb02g023140.1.313.549Sb02g023150.1.315.550Sb02g023150.1.315.550
Sb02g023160.1.346.558Sb02g023160.1.346.558Sb10g022440.1.382.605Sb10g022440.1.382.605Sb03g001450.1.355.568
Sb03g001450.1.355.568
Thellungiella halophilaThhalv10013093mThhalv10013113m.18.207Thhalv10013113m.18.207Thhalv10013113m.307.543Thhalv10013113m.307.543
Vitis viniferaGSVIVT01037479001GSVIVT01022165001GSVIVT01022172001GSVIVT01022168001GSVIVT01022181001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)