y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g15960.3
FamilyGH1
Protein PropertiesLength: 372 Molecular Weight: 41984.8 Isoelectric Point: 9.426
ChromosomeChromosome/Scaffold: 08 Start: 11648333 End: 11654809
Descriptionbeta glucosidase 31
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH12423694.2039e-45
  EPYITDLNWLFIFPKGIHLLMAHIKDKYKNLPIYITENGMAESRNDSIPVNEARKDSIRIRYHDGHLKFLLQAIKEGVNLKGYYAWSFSDSFEWDAGYTV
  RFGLIYVDYKNNLKRYPKFSAFWLQKFL
GH1442350
  SLFPSTFLFGIGSSAYQAEGAASVDGRGPSIWDTYTRQHTEKIWDHSTGDMGADFYHRYKGDIKIAKEIGLDSFRFSISWSRIFPKGKGAVNPLGVKFYN
  NVIDEILANGLKPFVTLFHWDFPQALEDEYGGFRSPKVVADFRGYANFCFKTFGDRVKYWVTLNEPLSFSLNGYNGGTFAPGRCSKYVANCS
Full Sequence
Protein Sequence     Length: 372     Download
MKTQSASLLC LFLSLAILLA SGTAASATPR SAVPSHHVST FNRSLFPSTF LFGIGSSAYQ    60
AEGAASVDGR GPSIWDTYTR QHTEKIWDHS TGDMGADFYH RYKGDIKIAK EIGLDSFRFS    120
ISWSRIFPKG KGAVNPLGVK FYNNVIDEIL ANGLKPFVTL FHWDFPQALE DEYGGFRSPK    180
VVADFRGYAN FCFKTFGDRV KYWVTLNEPL SFSLNGYNGG TFAPGRCSKY VANCSAGDSS    240
TEPYITDLNW LFIFPKGIHL LMAHIKDKYK NLPIYITENG MAESRNDSIP VNEARKDSIR    300
IRYHDGHLKF LLQAIKEGVN LKGYYAWSFS DSFEWDAGYT VRFGLIYVDY KNNLKRYPKF    360
SAFWLQKFLL K*                                                        420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02849PLN028493.0e-17255369116+
pfam00232Glyco_hydro_16.0e-39246368123+
TIGR03356BGL3.0e-6647279240+
PLN02849PLN028496.0e-6839272240+
pfam00232Glyco_hydro_12.0e-7146318282+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD03937.1052522248vicianin hydrolase [Vicia sativa subsp. nigra]
GenBankABD03937.10246371384509vicianin hydrolase [Vicia sativa subsp. nigra]
RefSeqXP_002512142.1012641249beta-glucosidase, putative [Ricinus communis]
RefSeqXP_002512142.14e-20246316384454beta-glucosidase, putative [Ricinus communis]
RefSeqXP_002512144.1012631258beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cbg_A03924612222A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB1cbg_A2e-36249371368490A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_B02426312254A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_B1e-37250371384505A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_A02426312254A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BW65533826412640
EV26700026412640
CA78278024612460
EH261755243222640
BG838865243222640
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_80.122
Citrus clementinaCiclev10015201m.21.131Ciclev10015201m.21.131
Citrus sinensisorange1.1g011733morange1.1g011332morange1.1g009558m.263.398orange1.1g009558m.263.398orange1.1g012826m.21.131
orange1.1g012826m.21.131
Cucumis sativusCucsa.029410.3.39.146Cucsa.029410.3.39.146
Glycine maxGlyma08g15960.3.44.235Glyma08g15960.3.44.235Glyma08g15976.1
Gossypium raimondiiGorai.008G271500.8.19.159Gorai.008G271500.8.19.159
Malus domesticaMDP0000284502.19.158MDP0000133222MDP0000772476MDP0000226997.39.150MDP0000226997.39.150
MDP0000232427.19.173MDP0000232427.19.173MDP0000284502.19.158
Oryza sativaLOC_Os11g08120.1
Panicum virgatumPavirv00054444mPavirv00056446mPavirv00050690m
Picea abiesMA_10425794g0020MA_781664g0010MA_10436515g0020MA_952732g0010.27.180MA_952732g0010.27.180
MA_946576g0010.42.153MA_10182879g0010MA_10431319g0010.36.144MA_10431319g0010.36.144MA_946576g0010.42.153
Prunus persicappa021869mppa022831m
Vitis viniferaGSVIVT01028004001.708.838GSVIVT01028004001.708.838GSVIVT01028004001.708.838GSVIVT01032021001GSVIVT01003998001
GSVIVT01028002001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny