y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g15960.5
FamilyGH1
Protein PropertiesLength: 141 Molecular Weight: 15977.2 Isoelectric Point: 9.4953
ChromosomeChromosome/Scaffold: 08 Start: 11652987 End: 11655213
Descriptionbeta glucosidase 17
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH111392.2e-30
  MKSSVGSRLPKFTKAESEGLKNSIDFLGVNYYTTYYAEHAEPVSANRTFYTDILASLSTERNGLHVGTPTDLNWLFIFPKGIHLLMAHIKDKYKNLPIYI
  TENGMAESRNDSIPVNEARKDSIRIRYHDGHLKFLLQAI
Full Sequence
Protein Sequence     Length: 141     Download
MKSSVGSRLP KFTKAESEGL KNSIDFLGVN YYTTYYAEHA EPVSANRTFY TDILASLSTE    60
RNGLHVGTPT DLNWLFIFPK GIHLLMAHIK DKYKNLPIYI TENGMAESRN DSIPVNEARK    120
DSIRIRYHDG HLKFLLQAIK *                                              180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029981.0e-151140142+
PLN02849PLN028494.0e-161140143+
TIGR03356BGL1.0e-169140133+
PLN02814PLN028148.0e-201140145+
pfam00232Glyco_hydro_19.0e-281139141+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD03937.101140315454vicianin hydrolase [Vicia sativa subsp. nigra]
GenBankACU18054.1011401140unknown [Glycine max]
RefSeqXP_002330884.15.60519e-451140315455predicted protein [Populus trichocarpa]
RefSeqXP_002334229.10114072212predicted protein [Populus trichocarpa]
RefSeqXP_002512142.11.4013e-451140315454beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B4e-331140310450A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptq_A4e-331140310450A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_B4e-331140310450A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptm_A4e-331140310450A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
PDB3ptk_B4e-331140310450A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AW83177014011400
BF06924014011400
AI90080114011400
BE32978614011400
CF80634214011400
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_346_00002.1
Eucalyptus grandisEucgr.K00923.1
Fragaria vescamrna26801.1-v1.0-hybrid
Glycine maxGlyma11g13766.2Glyma08g15993.1Glyma08g15960.4Glyma08g15950.2
Gossypium raimondiiGorai.008G271500.8.159.363Gorai.008G271500.8.159.363
Linum usitatissimumLus10011828.473.717Lus10000225Lus10011828.473.717
Malus domesticaMDP0000285510MDP0000295323MDP0000187265
Medicago truncatulaMedtr4g015460.2
Mimulus guttatusmgv1a025884mmgv1a014264m
Oryza sativaLOC_Os04g39814.3
Panicum virgatumPavirv00040514mPavirv00034317mPavirv00068709m
Phaseolus vulgarisPhvul.011G055700.2
Picea abiesMA_173229g0010
Populus trichocarpaPotri.T019200.1.296.514Potri.T177800.2Potri.T019200.1.296.514Potri.T177800.1Potri.T177800.3
Prunus persicappa026358mppa015721m
Vitis viniferaGSVIVT01032017001GSVIVT01032006001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny