y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g15976.1
FamilyGH1
Protein PropertiesLength: 171 Molecular Weight: 19011.6 Isoelectric Point: 6.5179
ChromosomeChromosome/Scaffold: 08 Start: 11658995 End: 11662589
Descriptionbeta glucosidase 17
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1671710
  SLFPSTFLFGIGSSAYQVEGAANEDGRGPSIWDNFTKEHPEKIWDQSTGDVGADFYHRYKSDIKLVKDIGLDSFRFSISWTRIFPKGKGAVNGLGVEFYN
  NLIDE
Full Sequence
Protein Sequence     Length: 171     Download
MKQIIQLILL YIESILDDSF GHKVEMRTKI VSLLCLLSLA TLLASGTESA SPISLKPSHK    60
ASSFNRSLFP STFLFGIGSS AYQVEGAANE DGRGPSIWDN FTKEHPEKIW DQSTGDVGAD    120
FYHRYKSDIK LVKDIGLDSF RFSISWTRIF PKGKGAVNGL GVEFYNNLID E             180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02998PLN029984.0e-3664171108+
PLN02814PLN028141.0e-3663171109+
COG2723BglB2.0e-4369171105+
pfam00232Glyco_hydro_15.0e-4769171103+
TIGR03356BGL7.0e-4970171102+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD03937.10321714144vicianin hydrolase [Vicia sativa subsp. nigra]
GenBankACU17400.10261711145unknown [Glycine max]
RefSeqXP_002330883.105617115132predicted protein [Populus trichocarpa]
RefSeqXP_002330884.10331719143predicted protein [Populus trichocarpa]
RefSeqXP_002512142.10261711143beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cbg_A4.00001e-406217112123A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB1v03_A5e-386617073179A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1
PDB1v02_F6e-376617073179A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1
PDB1v02_D6e-376617073179A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1
PDB1v02_C6e-376617073179A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DB969655120521710
BW669314120521710
AI966526120521710
BU091740120521710
DB973003120521710
Orthologous Group
SpeciesID
Carica papayaevm.model.supercontig_80.122
Citrus clementinaCiclev10015201m.21.131Ciclev10015201m.21.131
Citrus sinensisorange1.1g011733morange1.1g011332morange1.1g009558m.263.398orange1.1g009558m.263.398orange1.1g012826m.21.131
orange1.1g012826m.21.131
Cucumis sativusCucsa.029410.3.39.146Cucsa.029410.3.39.146
Glycine maxGlyma08g15960.3.44.235Glyma08g15960.3.44.235
Gossypium raimondiiGorai.008G271500.8.19.159Gorai.008G271500.8.19.159
Malus domesticaMDP0000284502.19.158MDP0000133222MDP0000772476MDP0000226997.39.150MDP0000226997.39.150
MDP0000232427.19.173MDP0000232427.19.173MDP0000284502.19.158
Oryza sativaLOC_Os11g08120.1
Panicum virgatumPavirv00054444mPavirv00056446mPavirv00050690m
Picea abiesMA_10425794g0020MA_781664g0010MA_10436515g0020MA_952732g0010.27.180MA_952732g0010.27.180
MA_946576g0010.42.153MA_10182879g0010MA_10431319g0010.36.144MA_10431319g0010.36.144MA_946576g0010.42.153
Prunus persicappa021869mppa022831m
Vitis viniferaGSVIVT01028004001.708.838GSVIVT01028004001.708.838GSVIVT01028004001.708.838GSVIVT01032021001GSVIVT01003998001
GSVIVT01028002001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny