y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g18130.2
FamilyGT33
Protein PropertiesLength: 486 Molecular Weight: 54654.6 Isoelectric Point: 7.4764
ChromosomeChromosome/Scaffold: 08 Start: 13604652 End: 13610507
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT33154760
  RACVVVLGDIGRSPRMQYDALSLANQASLEVDIVAYGGSEPHTALLANPSIHIYVMKQWLTASQSLPKILRSIMLLLKPLVQFCMLLWFLCVKIPSPDIF
  IVQNPPSVPTLVAVKWASWLRNSSFVIDWHNFGYTLLALSLGRNSHFVSLYKWFEKHYGKMADASLCVTKAMLHELAQNWGINATVLYDLPPDMFHPSSL
  EERHKHKLFCRLNEDLFQPLGVRDCVSNGTSLIASHRQNETLFTTEFGSNIYLKPNRPALVVSSMSWTPDKDFAILLEAAVMYDRRVAAIIGEDDSVDEE
  VMWKEISDAKQCLYPRLLFIITGKGPEKEKYEATIKGMKLKRVAFRTMWLSADDYPLLLGSADLGVCLHMSSSGLDLPMKVVDMFGCGLPVRAVSYSCIR
  ELVRLDKNGLLFSSSSELADELLLLFKGFPDDCEALEVLKYGALETGSSARWATEWEEQAKP
Full Sequence
Protein Sequence     Length: 486     Download
MLGKNDGKKR RRRGRACVVV LGDIGRSPRM QYDALSLANQ ASLEVDIVAY GGSEPHTALL    60
ANPSIHIYVM KQWLTASQSL PKILRSIMLL LKPLVQFCML LWFLCVKIPS PDIFIVQNPP    120
SVPTLVAVKW ASWLRNSSFV IDWHNFGYTL LALSLGRNSH FVSLYKWFEK HYGKMADASL    180
CVTKAMLHEL AQNWGINATV LYDLPPDMFH PSSLEERHKH KLFCRLNEDL FQPLGVRDCV    240
SNGTSLIASH RQNETLFTTE FGSNIYLKPN RPALVVSSMS WTPDKDFAIL LEAAVMYDRR    300
VAAIIGEDDS VDEEVMWKEI SDAKQCLYPR LLFIITGKGP EKEKYEATIK GMKLKRVAFR    360
TMWLSADDYP LLLGSADLGV CLHMSSSGLD LPMKVVDMFG CGLPVRAVSY SCIRELVRLD    420
KNGLLFSSSS ELADELLLLF KGFPDDCEAL EVLKYGALET GSSARWATEW EEQAKPLITE    480
VMSRF*                                                               540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00032argG7.0e-7329423104+
COG0438RfaG2.0e-883423345+
cd03801GT1_YqgM_like7.0e-1144423389+
cd03816GT1_ALG1_like8.0e-17716478465+
PLN02275PLN02275016423408+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI19390.101248311480unnamed protein product [Vitis vinifera]
RefSeqNP_173105.10124843461glycosyl transferase family 1 protein [Arabidopsis thaliana]
RefSeqXP_002283369.1012483126595PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330745.10124803467predicted protein [Populus trichocarpa]
RefSeqXP_002532170.1074842473beta1,4 mannosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesis2.4.1.142-RXNEC-2.4.1.142chitobiosyldiphosphodolichol β-mannosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW017293241162560
FG90402723512350
DV1321852741344070
GO872658336163510
CB5400432192054230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_718_00001.2Aquca_095_00006.1.267.395Aquca_095_00006.1.10.256Aquca_095_00006.1.10.256Aquca_095_00006.2.10.256
Aquca_095_00006.2.10.256Aquca_095_00006.1.267.395Aquca_718_00001.1Aquca_060_00040.3Aquca_095_00006.2.267.381
Aquca_095_00006.2.267.381Aquca_060_00040.2Aquca_060_00040.1
Arabidopsis lyrata490368879948912013
Arabidopsis thalianaAT1G16570.1AT1G16570.2
Brachypodium distachyonBradi1g72620.1
Brassica rapaBra026714Bra026039
Carica papayaevm.model.supercontig_132.61
Capsella rubellaCarubv10009200mCarubv10008948m
Chlamydomonas reinhardtiiCre12.g516550.t1.2
Citrus clementinaCiclev10001033mCiclev10001025mCiclev10001005m
Citrus sinensisorange1.1g015058morange1.1g014316morange1.1g011690morange1.1g011969morange1.1g011979m
Cucumis sativusCucsa.034380.1
Eucalyptus grandisEucgr.F01412.2Eucgr.F01412.1
Fragaria vescamrna02356.1-v1.0-hybrid
Glycine maxGlyma15g40830.1Glyma15g40830.2
Gossypium raimondiiGorai.007G217600.1Gorai.007G217900.6Gorai.007G217900.3.324.433Gorai.007G217900.3.13.332Gorai.007G217900.7
Gorai.007G217900.3.13.332Gorai.006G005600.3.168.254Gorai.006G005600.3.168.254Gorai.007G217900.3.324.433Gorai.007G217900.5.326.428
Gorai.007G217900.5.326.428Gorai.006G005600.2.168.254Gorai.006G005600.2.168.254Gorai.006G005600.1.168.319Gorai.007G217900.4
Gorai.006G005600.1.168.319Gorai.007G217900.1Gorai.007G217900.2
Linum usitatissimumLus10031569.147.292Lus10031569.147.292Lus10026065Lus10014357
Malus domesticaMDP0000161006.80.246MDP0000159170MDP0000159220MDP0000161006.80.246MDP0000161006.247.440
MDP0000161006.247.440
Manihot esculentacassava4.1_013829mcassava4.1_014658mcassava4.1_016683mcassava4.1_016689m
Medicago truncatulaMedtr2g069330.1
Mimulus guttatusmgv1a005765m
Oryza sativaLOC_Os03g08300.2LOC_Os03g08300.1LOC_Os06g36890.1
Panicum virgatumPavirv00056539mPavirv00038448m
Physcomitrella patensPp1s12_194V6.1
Phaseolus vulgarisPhvul.005G057900.1
Picea abiesMA_179056g0010
Populus trichocarpaPotri.001G394300.4Potri.001G394300.1Potri.001G394300.2Potri.001G394300.3
Prunus persicappa006637mppa005066mppa005033m
Ricinus communis27893.m000222
Setaria italicaSi035510m
Selaginella moellendorffii82712
Sorghum bicolorSb01g045200.1
Thellungiella halophilaThhalv10007520mThhalv10007572m
Vitis viniferaGSVIVT01009332001
Volvox carteriVocar20014254m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)