y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g20020.1
FamilyGT24
Protein PropertiesLength: 1631 Molecular Weight: 184151 Isoelectric Point: 6.0031
ChromosomeChromosome/Scaffold: 08 Start: 15085821 End: 15103814
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT24132615730
  INIFSIASGHLYERFLKIMILSVLKNTHRPVKFWFIKNYLSPPFKDLIPHMAQEYGFECELITYKWPTWLHKQKEKQRIIWAYKILFLDVIFPLSLEKVI
  FVDADQIVRTDMGELYDMDIKGKPLAYTPFCDNNREMDGYRFWRQGFWKDHLRGKPYHISALYVVDLKKFRETASGDNLRVFYETLSKDPNSLANLDQDL
  PNYAQHIVPIFSLPQEWLWCESWCGNATKSKAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1631     Download
MGDLIELSER VRVYVMGYRS ACLVLILFLI LGIGTGIASS ETPRPKNVQA SLGAKWSGTP    60
LLLEAGELLS KEDPRLFWDF IDIWLNAAAD DQSHSAKACV IEILHHARPL LRQPLASLFE    120
FSLILRSASP ALVLYRQLAH DSLASFPLQD ARAHAEITKL DPLRLGISLK SPGGKCCWVH    180
TSQNLFFDVS QLLSWLQTQT PVGDSSQRPQ LFDFDHVHFD SSAGGPVAIL YGALGTGCFK    240
DFHAALAEAA KQGKVNYVLR PVLPAGCETN FGHCGSVGAS DSVNLGGYGV ELAFKNMEYK    300
AMDDSAIKKG VTLEDPRTED LSQEVRGFIF SKILERKPEL ASEIMTFRDY LLSSTVSDTL    360
DVWELKDLGH QTVQRIVRAS DPLQSMHDIN QNFPNIVSSL SRMKLDDSVQ DEIMANQRMI    420
PPGKSLMAIN GALVNVEDID LYLLIDLVHQ DLLLADQFSK LKIPHSTVRK LLSTSPPSES    480
SMFRVDFRTT HVHYLNNLEE DAKYKRWRSN LNEILMPVFP GQLRHIRKNL FHAVFVLDPA    540
TICGLESIDT IISLYENNFP VRFGIVLYSS KSITRLENHS AKEDGDKFEE DISDMIIRLF    600
SYIKGNHGIQ LAFEFLSNVN KLRIESDDHI DDAHLELHHV EGAFVETILP KVKSPPQEIL    660
LKLQKEPELK ELSQESSMLV FKLGLSKIHC SLLMNGLVID PTEEALLNAL NDETQRIQEQ    720
VYFGQIKSHT DVLDKFLSEA GIQRYNPRII SDNKPRFISL SKFIFGEASI LNDIDYLHSP    780
GTMDDLKPVT HLLAVDITSG SGLHLLRQGL NYLREGSKEA RIGFLFSANQ STDSFSLLFV    840
KVFEITSSSY SHKKNVLDFL EQLCSLYQQK YLLSSAVEAD SIQAFIDKVC ELAEANGLPS    900
DGYRSALPEF SADEVRRHLS KVENFFHRVL GSESSANAVF TNGRVTYPID ESTFLSPDLL    960
LLESIEFKQR TKHILEIIEE VKWQDVDPDM LTSKFISDIV MTVSSSMATR ERSSESARFE    1020
MLNDQHSAII LHNENSSIHI DACLDPLSPT SQKLSGILRV LWKYIQPSMR IVLNPLSSLA    1080
DLPLKNYYRY VVPSMDDFSS ADSSINGPKA FFANMPLSKT LTMNLDVPEP WLVEPVIAVH    1140
DLDNILLENL GDTRTLQAIF ELEALVLTGH CSEKDHDPPR GLQLILGTKT TPHLVDTIVM    1200
ANLGYWQMKV SPGVWFLQLA PGRSSELYIL KEGVDGIQIK QSSKFIIIND LRGKVVHMDV    1260
VKRKGKEHEK LLISDDDAPQ DKKKESSWNS NLLKWASGFI SSNEQPKNAE TNSPEKGRGG    1320
RHGKTINIFS IASGHLYERF LKIMILSVLK NTHRPVKFWF IKNYLSPPFK DLIPHMAQEY    1380
GFECELITYK WPTWLHKQKE KQRIIWAYKI LFLDVIFPLS LEKVIFVDAD QIVRTDMGEL    1440
YDMDIKGKPL AYTPFCDNNR EMDGYRFWRQ GFWKDHLRGK PYHISALYVV DLKKFRETAS    1500
GDNLRVFYET LSKDPNSLAN LDQDLPNYAQ HIVPIFSLPQ EWLWCESWCG NATKSKAKTI    1560
DLCNNPMTKE PKLQGARRIV SEWPDLDLEA SKFTARILGD DLEPLQSPNQ SKDLTSEGAL    1620
KEDLESKAEL *                                                         1680
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01501Glyco_transf_81.0e-513301525206+
cd04194GT8_A4GalT_like5.0e-1713261542227+
cd00505Glyco_transf_87.0e-5613261573257+
pfam06427UDP-g_GGTase5.0e-799971202212+
cd06432GT8_HUGT1_C_like4.0e-17213261573248+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.10231630111674AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
DDBJBAD28382.10411603331602putative UDP-glucose:glycoprotein glucosyltransferase [Oryza sativa Japonica Group]
RefSeqNP_177278.30231630111613EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.1018163051611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002529534.1018152351499UDP-glucose glycoprotein:glucosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2138
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO797114367126716310
HO415354544106815970
GO883503326128916130
HO781411204128014820
HO41535415991210696e-19
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma20g20260.1Glyma05g30230.1Glyma08g20020.2Glyma08g13400.1
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny