y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g20020.2
FamilyGT24
Protein PropertiesLength: 1037 Molecular Weight: 117945 Isoelectric Point: 6.0568
ChromosomeChromosome/Scaffold: 08 Start: 15092060 End: 15103814
DescriptionUDP-glucose:glycoprotein glucosyltransferases;transferases, transferring hexosyl groups;transferases, transferring glycosyl groups
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT247329790
  INIFSIASGHLYERFLKIMILSVLKNTHRPVKFWFIKNYLSPPFKDLIPHMAQEYGFECELITYKWPTWLHKQKEKQRIIWAYKILFLDVIFPLSLEKVI
  FVDADQIVRTDMGELYDMDIKGKPLAYTPFCDNNREMDGYRFWRQGFWKDHLRGKPYHISALYVVDLKKFRETASGDNLRVFYETLSKDPNSLANLDQDL
  PNYAQHIVPIFSLPQEWLWCESWCGNATKSKAKTIDLCNNPMTKEPKL
Full Sequence
Protein Sequence     Length: 1037     Download
MIIRLFSYIK GNHGIQLAFE FLSNVNKLRI ESDDHIDDAH LELHHVEGAF VETILPKVKS    60
PPQEILLKLQ KEPELKELSQ ESSMLVFKLG LSKIHCSLLM NGLVIDPTEE ALLNALNDET    120
QRIQEQVYFG QIKSHTDVLD KFLSEAGIQR YNPRIISDNK PRFISLSKFI FGEASILNDI    180
DYLHSPGTMD DLKPVTHLLA VDITSGSGLH LLRQGLNYLR EGSKEARIGF LFSANQSTDS    240
FSLLFVKVFE ITSSSYSHKK NVLDFLEQLC SLYQQKYLLS SAVEADSIQA FIDKVCELAE    300
ANGLPSDGYR SALPEFSADE VRRHLSKVEN FFHRVLGSES SANAVFTNGR VTYPIDESTF    360
LSPDLLLLES IEFKQRTKHI LEIIEEVKWQ DVDPDMLTSK FISDIVMTVS SSMATRERSS    420
ESARFEMLND QHSAIILHNE NSSIHIDACL DPLSPTSQKL SGILRVLWKY IQPSMRIVLN    480
PLSSLADLPL KNYYRYVVPS MDDFSSADSS INGPKAFFAN MPLSKTLTMN LDVPEPWLVE    540
PVIAVHDLDN ILLENLGDTR TLQAIFELEA LVLTGHCSEK DHDPPRGLQL ILGTKTTPHL    600
VDTIVMANLG YWQMKVSPGV WFLQLAPGRS SELYILKEGV DGIQIKQSSK FIIINDLRGK    660
VVHMDVVKRK GKEHEKLLIS DDDAPQDKKK ESSWNSNLLK WASGFISSNE QPKNAETNSP    720
EKGRGGRHGK TINIFSIASG HLYERFLKIM ILSVLKNTHR PVKFWFIKNY LSPPFKDLIP    780
HMAQEYGFEC ELITYKWPTW LHKQKEKQRI IWAYKILFLD VIFPLSLEKV IFVDADQIVR    840
TDMGELYDMD IKGKPLAYTP FCDNNREMDG YRFWRQGFWK DHLRGKPYHI SALYVVDLKK    900
FRETASGDNL RVFYETLSKD PNSLANLDQD LPNYAQHIVP IFSLPQEWLW CESWCGNATK    960
SKAKTIDLCN NPMTKEPKLQ GARRIVSEWP DLDLEASKFT ARILGDDLEP LQSPNQSKDL    1020
TSEGALKEDL ESKAEL*                                                   1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01501Glyco_transf_81.0e-5736931206+
cd04194GT8_A4GalT_like9.0e-17732948227+
cd00505Glyco_transf_87.0e-56732979257+
pfam06427UDP-g_GGTase5.0e-80403608212+
cd06432GT8_HUGT1_C_like6.0e-176732979248+
Gene Ontology
GO TermDescription
GO:0003980UDP-glucose:glycoprotein glucosyltransferase activity
GO:0006486protein glycosylation
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG51883.10110365881674AC016162_4 putative UDP-glucose:glycoprotein glucosyltransferase; 101200-91134 [Arabidopsis thaliana]
GenBankEEE57527.10110095511573hypothetical protein OsJ_07839 [Oryza sativa Japonica Group]
RefSeqNP_177278.30110365681613EBS1 (EMS-mutagenized bri1 suppressor 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Arabidopsis thaliana]
RefSeqXP_002268972.10110365711611PREDICTED: similar to EBS1 (EMS-MUTAGENIZED BRI1 SUPPRESSOR 1); UDP-glucose:glycoprotein glucosyltransferase/ transferase, transferring glycosyl groups / transferase, transferring hexosyl groups [Vitis vinifera]
RefSeqXP_002529534.1019295661499UDP-glucose glycoprotein:glucosyltransferase, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO79711436767310370
HO41535454447410030
GO88350332669510190
DR94461827872510020
HO4153541593184752e-19
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_023_00011.1
Arabidopsis lyrata894960
Arabidopsis thalianaAT1G71220.2AT1G71220.1
Brachypodium distachyonBradi3g28605.1
Brassica rapaBra016154
Capsella rubellaCarubv10022452m
Chlamydomonas reinhardtiig5108.t1g5108.t2
Citrus clementinaCiclev10000024m
Citrus sinensisorange1.1g001078morange1.1g000334morange1.1g000842morange1.1g001779morange1.1g000402m
orange1.1g000446morange1.1g000445m
Cucumis sativusCucsa.033020.2Cucsa.033020.1
Eucalyptus grandisEucgr.H01580.1Eucgr.I02739.1Eucgr.H01552.1.95.175Eucgr.H01552.1.95.175
Fragaria vescamrna11048.1-v1.0-hybrid
Glycine maxGlyma20g20260.1Glyma05g30230.1Glyma08g20020.1Glyma08g13400.1
Gossypium raimondiiGorai.012G151700.5Gorai.008G027900.1Gorai.012G151700.3Gorai.012G151700.2Gorai.012G151700.4
Linum usitatissimumLus10019946Lus10015475
Malus domesticaMDP0000231077MDP0000439201
Manihot esculentacassava4.1_000150m
Medicago truncatulaMedtr2g006960.1
Mimulus guttatusmgv1a000151m
Oryza sativaLOC_Os02g44510.3LOC_Os02g44510.2LOC_Os02g44510.1
Panicum virgatumPavirv00007561mPavirv00061408m
Physcomitrella patensPp1s25_65V6.1
Phaseolus vulgarisPhvul.006G215600.1
Picea abiesMA_10435601g0010
Populus trichocarpaPotri.003G018900.1
Prunus persicappa000323m
Ricinus communis29222.m000396
Setaria italicaSi033881m
Selaginella moellendorffii186368
Sorghum bicolorSb04g036540.1
Thellungiella halophilaThhalv10018004m
Vitis viniferaGSVIVT01022867001
Volvox carteriVocar20012786m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny