y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g25901.1
FamilyGH28
Protein PropertiesLength: 155 Molecular Weight: 17057.2 Isoelectric Point: 7.2031
ChromosomeChromosome/Scaffold: 08 Start: 20315298 End: 20316072
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2821497.1e-34
  TFMLKPLQFSCPCSFSLVHFQVEGDVVTPKSTEAWKGQDSSKWIDFSNVNGLIIDEGGQIDGSGSIWWNSCKVKCCLRPTALSIHNCNNLQLTGIRHLNS
  ARNHISINNSNHNHIFNVNIDAPLDSPNINGIDVSQSSYTLIQHSTIA
Full Sequence
Protein Sequence     Length: 155     Download
ETFMLKPLQF SCPCSFSLVH FQVEGDVVTP KSTEAWKGQD SSKWIDFSNV NGLIIDEGGQ    60
IDGSGSIWWN SCKVKCCLRP TALSIHNCNN LQLTGIRHLN SARNHISINN SNHNHIFNVN    120
IDAPLDSPNI NGIDVSQSSY TLIQHSTIAI GKRH*                               180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00295Glyco_hydro_287.0e-162151153+
PLN02218PLN022189.0e-182151157+
PLN02793PLN027932.0e-222151155+
PLN03010PLN030104.0e-231151151+
PLN03003PLN030035.0e-272151150+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAY21049.12e-34115172226PGN [Glycine max]
GenBankABC75354.13e-36115165214Glycoside hydrolase, family 28 [Medicago truncatula]
GenBankABO81149.10115140191Glycoside hydrolase, family 28 [Medicago truncatula]
RefSeqNP_197222.12e-31115180224glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana]
RefSeqXP_002515526.14e-34115169216Polygalacturonase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1nhc_F0.0025314872171A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_E0.0025314872171A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_D0.0025314872171A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_C0.0025314872171A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
PDB1nhc_B0.0025314872171A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2103EC-3.2.1.15polygalacturonase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CV53812715311511e-28
GE48397315621519e-28
EY94591715111517e-26
EY95006915111517e-26
CX19229315111514e-25
Orthologous Group
SpeciesID
Brassica rapaBra040077
Citrus sinensisorange1.1g047411m
Fragaria vescamrna30795.1-v1.0-hybrid
Glycine maxGlyma17g31721.1
Gossypium raimondiiGorai.011G082300.1
Malus domesticaMDP0000600336MDP0000146841
Prunus persicappa021254m.37.202ppa021254m.37.202
Vitis viniferaGSVIVT01017354001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny