y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g26935.1
FamilyGH81
Protein PropertiesLength: 653 Molecular Weight: 72746 Isoelectric Point: 5.3286
ChromosomeChromosome/Scaffold: 08 Start: 21266140 End: 21268098
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81136480
  VLSDPSTYFSSNLLSSPLPTNSFFQNFVIPNGSQAEYIHPYLIKTSNSSLSASYPLLILFTTAVLYQTFVADITISSTQTTSQNHVISSYSDLGVTLDIP
  SSNLRFFLSRGSPFLTVSVTSPTSLSITTVHTIVSLSSNDDNNTKYTLKLNNTQTWLIYTSSPIYFTHNNASEVTSKPFSGIIRVAVLPNHNYVTILDKF
  STCYPLSGNATLVEPFRVVYEWQKEGSGDLLMLAHPLHVKLLSNNYNGLVTVLNDFKYRSIDGDLVGVVGDSWVLETNPIPVTWYSNKGMEKDSYDEIVS
  ALVKDVQELNSSSIGTSSSYFYGKRVGRAARLALIAEEVSFSNVVPTIKKFLKESIEPWLDGTLQGNGFLYENKWGGLVTKLGSTDSTADFGFGVYNDHH
  YHLGYFLYGIAVLAKIDPEWGQKYNPQVYSLVTDFMNLGQKYNSRYPRLRCFDLYNLHSWASGVTEFADGRNQESTSEAVNAYYSAALVGLAYGDSNLVA
  IGSTLLALEILAAQTWWHVKAEGNLYEEEFAKENKIVGVLWANKRDSALWWGPATCRECRLGIQVLPLSPVTETLFSDADYVKELVEWTMPSLTSEGWKG
  MTYALQGIYDKETALENIRKLKGFDDGNSLSNLLWW
Full Sequence
Protein Sequence     Length: 653     Download
MSSFLFPQTQ STVLSDPSTY FSSNLLSSPL PTNSFFQNFV IPNGSQAEYI HPYLIKTSNS    60
SLSASYPLLI LFTTAVLYQT FVADITISST QTTSQNHVIS SYSDLGVTLD IPSSNLRFFL    120
SRGSPFLTVS VTSPTSLSIT TVHTIVSLSS NDDNNTKYTL KLNNTQTWLI YTSSPIYFTH    180
NNASEVTSKP FSGIIRVAVL PNHNYVTILD KFSTCYPLSG NATLVEPFRV VYEWQKEGSG    240
DLLMLAHPLH VKLLSNNYNG LVTVLNDFKY RSIDGDLVGV VGDSWVLETN PIPVTWYSNK    300
GMEKDSYDEI VSALVKDVQE LNSSSIGTSS SYFYGKRVGR AARLALIAEE VSFSNVVPTI    360
KKFLKESIEP WLDGTLQGNG FLYENKWGGL VTKLGSTDST ADFGFGVYND HHYHLGYFLY    420
GIAVLAKIDP EWGQKYNPQV YSLVTDFMNL GQKYNSRYPR LRCFDLYNLH SWASGVTEFA    480
DGRNQESTSE AVNAYYSAAL VGLAYGDSNL VAIGSTLLAL EILAAQTWWH VKAEGNLYEE    540
EFAKENKIVG VLWANKRDSA LWWGPATCRE CRLGIQVLPL SPVTETLFSD ADYVKELVEW    600
TMPSLTSEGW KGMTYALQGI YDKETALENI RKLKGFDDGN SLSNLLWWIH SR*           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF24.0e-54168651528+
pfam03639Glyco_hydro_814.0e-1729652699+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69782.1016521660beta-glucan-binding protein 2 [Medicago truncatula]
GenBankABB69784.10465211665beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.1026528665beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.1026528665beta-glucan binding protein [Glycine max]
RefSeqXP_002282971.10265266723PREDICTED: hypothetical protein [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6916552782975740
HO6493955341686530
ES8165422912835730
JG6583242643816440
GR9996172643606190
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma13g07220.1
Glyma08g27000.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2Glyma13g07210.2.390.614
Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)