y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g26940.1
FamilyGH81
Protein PropertiesLength: 658 Molecular Weight: 73845.8 Isoelectric Point: 7.9906
ChromosomeChromosome/Scaffold: 08 Start: 21271972 End: 21273945
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81136530
  TVLPDPSTYFSPNLLSSPLPTNSFFQNFVIPNGTQPEYIHPYLIKTSNSSLSASYPLLFFTTAVLYQAFVPDITISSPQTHSRQQNRVISSYSDLGVTLD
  IPSSNLRFFLSRGSPFITASVTKPTSLSITTVHTIVSLSANDDKNTKYTLKLNNTQAWLIYTSSPIYLNHDAASNVTSKPFSGIIRVAVLPDSNSKCVKI
  LDKFSSCYPLSGNATLEKPFRVVYEWLKEGSGNLLMLAHPLHVKILSSTNNGQVNVLRHFKYRSIDGDLVGVVGDSWVMETNPIPVTWYSNKGVEKESYD
  EIVSALVTDVQGLNSSAIETIISSYFYGKRVGRAARFALIAEEVSFPKVIPSVKKFLKETIEPWLDGTFPGNGFQYENKWGGLVTKLGSTDSTADFGFGI
  YNDHHYHLGNFLYGIAVLAKIDPQWGQKYKPQVYSLVTDFMNLGPSYNRFYPRLRNFDLYKLHSWAAGLTEFEHGRNQESTSEAVTAYYSAALVGLAYGD
  SSLVATGSTLMALEILAAQTWWHVKEKDNLYEEEFAKENRVVGILWANKRDSKLWWARAECRECRLGIQVLPLLPITETLFSDADYAKELVEWTLPSARR
  EGWKGMTYALQGIYDRKTALQNIRMLKGFDDGNSFTNLLWW
Full Sequence
Protein Sequence     Length: 658     Download
MSSSFLFPQT QSTVLPDPST YFSPNLLSSP LPTNSFFQNF VIPNGTQPEY IHPYLIKTSN    60
SSLSASYPLL FFTTAVLYQA FVPDITISSP QTHSRQQNRV ISSYSDLGVT LDIPSSNLRF    120
FLSRGSPFIT ASVTKPTSLS ITTVHTIVSL SANDDKNTKY TLKLNNTQAW LIYTSSPIYL    180
NHDAASNVTS KPFSGIIRVA VLPDSNSKCV KILDKFSSCY PLSGNATLEK PFRVVYEWLK    240
EGSGNLLMLA HPLHVKILSS TNNGQVNVLR HFKYRSIDGD LVGVVGDSWV METNPIPVTW    300
YSNKGVEKES YDEIVSALVT DVQGLNSSAI ETIISSYFYG KRVGRAARFA LIAEEVSFPK    360
VIPSVKKFLK ETIEPWLDGT FPGNGFQYEN KWGGLVTKLG STDSTADFGF GIYNDHHYHL    420
GNFLYGIAVL AKIDPQWGQK YKPQVYSLVT DFMNLGPSYN RFYPRLRNFD LYKLHSWAAG    480
LTEFEHGRNQ ESTSEAVTAY YSAALVGLAY GDSSLVATGS TLMALEILAA QTWWHVKEKD    540
NLYEEEFAKE NRVVGILWAN KRDSKLWWAR AECRECRLGI QVLPLLPITE TLFSDADYAK    600
ELVEWTLPSA RREGWKGMTY ALQGIYDRKT ALQNIRMLKG FDDGNSFTNL LWWIHSR*      660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF22.0e-6516656706+
pfam03639Glyco_hydro_81010657698+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69782.1026573660beta-glucan-binding protein 2 [Medicago truncatula]
GenBankABB69784.10565711665beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.1026577665beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.1026577665beta-glucan binding protein [Glycine max]
RefSeqXP_002282971.10265765723PREDICTED: hypothetical protein [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6916552793015790
HO6493955481576580
ES8165422922875780
FE6928602214386580
JG6583242643866490
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26980.1Glyma13g07240.2Glyma13g07210.2.390.614
Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)