y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g26980.1
FamilyGH81
Protein PropertiesLength: 630 Molecular Weight: 70587.6 Isoelectric Point: 6.8707
ChromosomeChromosome/Scaffold: 08 Start: 21312255 End: 21314470
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81196250
  TVLPNPSTYFSSNLVSSPLPTNSFFQNFALQNGTQAEYIHPYLIKTSNFSLSASCPLLLFTTAVLYQTFVADITISSTQTTSQNHVISSYSDLGRGSPYI
  TASVTKPTSLSITTVRSIVSLCSNNKENTKYTLKLNNTQTWLIYTSSPIYLNHDAASNITSKHFLAQFASALVTRSLSGNATLVKPFRVTYEWQKKGPGF
  LLTLAHPLHVKLLQYKKNHRMIVLRDFKYRSIDGDLVGVVGDSWLLKTDTIPVTWHSNKGVEKESHDEIVSALSKDVEALSSSPIATESSYYYGKLIGRA
  ARLALIAEEVSSPNVIPTIQKFLKDSIEPWLDGTFQGNGFLYENKWGGLVTKQGSTDSGADFGFGVYNDHHYHLGYFLYGIAVLAKVDLQWGQKYKPQVY
  SLVSDFMNSGQKYNSHYPRLRCFDLYKLHSWTSGVTEFTDGRNQESTSEAVNAYYSAALVGLAYDDSNLVATGSTLLALEILAAQTWWHVKAEGNLYEEE
  FAKENKIVDALWANKRDSALWWAPATCRECRLGIEVLPLSPVTETLFYDADYVKELVEWTMPSLTSEGWKGMTYALQGIYDKETVLQNIRMLTGFDDGNS
  FTNLLWW
Full Sequence
Protein Sequence     Length: 630     Download
MESPHNNTAR NYFSQTQSTV LPNPSTYFSS NLVSSPLPTN SFFQNFALQN GTQAEYIHPY    60
LIKTSNFSLS ASCPLLLFTT AVLYQTFVAD ITISSTQTTS QNHVISSYSD LGRGSPYITA    120
SVTKPTSLSI TTVRSIVSLC SNNKENTKYT LKLNNTQTWL IYTSSPIYLN HDAASNITSK    180
HFLAQFASAL VTRSLSGNAT LVKPFRVTYE WQKKGPGFLL TLAHPLHVKL LQYKKNHRMI    240
VLRDFKYRSI DGDLVGVVGD SWLLKTDTIP VTWHSNKGVE KESHDEIVSA LSKDVEALSS    300
SPIATESSYY YGKLIGRAAR LALIAEEVSS PNVIPTIQKF LKDSIEPWLD GTFQGNGFLY    360
ENKWGGLVTK QGSTDSGADF GFGVYNDHHY HLGYFLYGIA VLAKVDLQWG QKYKPQVYSL    420
VSDFMNSGQK YNSHYPRLRC FDLYKLHSWT SGVTEFTDGR NQESTSEAVN AYYSAALVGL    480
AYDDSNLVAT GSTLLALEIL AAQTWWHVKA EGNLYEEEFA KENKIVDALW ANKRDSALWW    540
APATCRECRL GIEVLPLSPV TETLFYDADY VKELVEWTMP SLTSEGWKGM TYALQGIYDK    600
ETVLQNIRML TGFDDGNSFT NLLWWIHSR*                                     660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF22.0e-4422628697+
pfam03639Glyco_hydro_815.0e-16314629703+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69782.10136298660beta-glucan-binding protein 2 [Medicago truncatula]
GenBankABB69784.101362913665beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.101362912665beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.101362912665beta-glucan binding protein [Glycine max]
RefSeqXP_002282971.10162953723PREDICTED: hypothetical protein [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6916552782745510
ES8165422912605500
GR9264052632525140
GR9996172643375960
JG6583242643586210
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g27000.1Glyma08g26940.1Glyma13g07240.2Glyma13g07210.2.390.614
Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)