y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g27000.1
FamilyGH81
Protein PropertiesLength: 654 Molecular Weight: 73409.2 Isoelectric Point: 7.1831
ChromosomeChromosome/Scaffold: 08 Start: 21349094 End: 21351570
Descriptionglycosyl hydrolase family 81 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH81146490
  VIPDPSTYFSPNLLSSPLPTNSFFQNFVIPNGTQPEYIHPYLIQSSNSSLSASFPLLLFTTALLYQAFVPDLTISASKTYSSYQQNRVVSSYSDLGVTLD
  IPSSNLRFFLVRGSPYITASVTKPTPLSIKTVHTVVSLSSDDYNTKHTLKLNNSQAWIIYTSSPIYLNHVPSEVTSKPFSGIIRIAALPDSDSKYVETLD
  KFSSCYPVSGDAALKKPFSVEYKWQKKRSGDLLMLAHPLHAKLLSYDRDVTVLNDFKYRSIDGDLVGVVGDSWVLETNPIPVTWNSNKGVEKESYGEIVT
  ALVKDVQALNSSAIGTNSSYFYGKQVGRAARLALIAEEVSYPKVIPKVKKFLKETIEPWLDGTFKGNAFLYERKWRGLVTKHGSTDSTADFGFGIYNDHH
  FHLGYFIYGIAVLAKIDPQWGQKYKPQVYSLVTDFMNLGQRYNSDYTRLRCFDLYKLHSWAAGLTEFEDGRNQESTSEAVNAYYAAALLGLAYGDSSLVD
  TGSTLVALEILAAQTWWHVKAEDNLYEEEFAKDNRIVGVLWANKRDSKLWWAPATCRECRLGIQVLPLLPITETLFSDADYVKELVEWTVPFLSSQGWKG
  MTYALQGIYDKKTALQNIRKLTGFDDGNSFTNLLWW
Full Sequence
Protein Sequence     Length: 654     Download
MSSSFLFPQT QSTVIPDPST YFSPNLLSSP LPTNSFFQNF VIPNGTQPEY IHPYLIQSSN    60
SSLSASFPLL LFTTALLYQA FVPDLTISAS KTYSSYQQNR VVSSYSDLGV TLDIPSSNLR    120
FFLVRGSPYI TASVTKPTPL SIKTVHTVVS LSSDDYNTKH TLKLNNSQAW IIYTSSPIYL    180
NHVPSEVTSK PFSGIIRIAA LPDSDSKYVE TLDKFSSCYP VSGDAALKKP FSVEYKWQKK    240
RSGDLLMLAH PLHAKLLSYD RDVTVLNDFK YRSIDGDLVG VVGDSWVLET NPIPVTWNSN    300
KGVEKESYGE IVTALVKDVQ ALNSSAIGTN SSYFYGKQVG RAARLALIAE EVSYPKVIPK    360
VKKFLKETIE PWLDGTFKGN AFLYERKWRG LVTKHGSTDS TADFGFGIYN DHHFHLGYFI    420
YGIAVLAKID PQWGQKYKPQ VYSLVTDFMN LGQRYNSDYT RLRCFDLYKL HSWAAGLTEF    480
EDGRNQESTS EAVNAYYAAA LLGLAYGDSS LVDTGSTLVA LEILAAQTWW HVKAEDNLYE    540
EEFAKDNRIV GVLWANKRDS KLWWAPATCR ECRLGIQVLP LLPITETLFS DADYVKELVE    600
WTVPFLSSQG WKGMTYALQG IYDKKTALQN IRKLTGFDDG NSFTNLLWWI HSR*          660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5498ACF24.0e-6516652701+
pfam03639Glyco_hydro_81010653696+
Gene Ontology
GO TermDescription
GO:0016998cell wall macromolecule catabolic process
GO:0033903endo-1,3(4)-beta-glucanase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB69782.1026533660beta-glucan-binding protein 2 [Medicago truncatula]
GenBankABB69784.10565311665beta-glucan-binding protein 4 [Medicago truncatula]
DDBJBAA11407.1026537665beta-glucan-elicitor receptor [Glycine max]
EMBLCAA71307.1026537665beta-glucan binding protein [Glycine max]
RefSeqXP_002282971.10265365723PREDICTED: hypothetical protein [Vitis vinifera]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE6916552772995750
HO6493955551486540
ES8165422912845740
FE6916572921814710
CA78439021712170
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01041.1
Arabidopsis lyrata909564
Arabidopsis thalianaAT5G15870.1AT1G18310.1
Brachypodium distachyonBradi4g29390.1
Brassica rapaBra023544Bra008667Bra025916
Carica papayaevm.TU.contig_34602.1evm.model.supercontig_179.46
Capsella rubellaCarubv10000292mCarubv10008525m
Chlamydomonas reinhardtiiCre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714Cre12.g513400.t1.3.13.714
Citrus clementinaCiclev10011145m
Citrus sinensisorange1.1g042050m
Cucumis sativusCucsa.238220.1Cucsa.238230.1Cucsa.237660.1
Eucalyptus grandisEucgr.I02120.1Eucgr.I02118.1Eucgr.I02113.1Eucgr.L01291.1Eucgr.I02117.1
Eucgr.L01293.1Eucgr.L01292.1Eucgr.L01830.1Eucgr.L01010.1Eucgr.L01290.1
Eucgr.I02115.1Eucgr.I02114.1
Fragaria vescamrna10352.1-v1.0-hybridmrna04398.1-v1.0-hybridmrna25909.1-v1.0-hybridmrna04399.1-v1.0-hybridmrna24770.1-v1.0-hybrid
Glycine maxGlyma19g05550.2Glyma13g07230.2Glyma18g50180.1Glyma18g50220.1Glyma08g26935.1
Glyma13g07220.1Glyma08g26940.1Glyma08g26980.1Glyma13g07240.2Glyma13g07210.2.390.614
Glyma13g07210.2.390.614Glyma03g04290.1Glyma13g07210.2.22.372Glyma13g07210.2.22.372
Gossypium raimondiiGorai.001G082200.1Gorai.007G368000.1
Linum usitatissimumLus10021987Lus10042525Lus10042526
Malus domesticaMDP0000148377MDP0000314562MDP0000855663MDP0000695045MDP0000199068
MDP0000517518MDP0000206670
Manihot esculentacassava4.1_002382m
Medicago truncatulaAC233685_94.1AC233572_18.1AC233685_92.1AC233572_20.1Medtr7g013170.1
AC233572_21.1AC233572_19.1AC233572_25.1AC233685_93.1AC233572_23.1
AC233572_30.1AC233685_76.1AC233572_29.1AC233685_33.1AC233685_46.1
AC233685_68.1AC233685_75.1AC233685_34.1AC233685_74.1Medtr1g079270.1
Medtr7g112730.1
Mimulus guttatusmgv1a002257m
Oryza sativaLOC_Os09g21210.1
Panicum virgatumPavirv00025146mPavirv00045049mPavirv00057587mPavirv00052228m
Physcomitrella patensPp1s16_374V6.1
Phaseolus vulgarisPhvul.004G049300.1Phvul.008G033100.1Phvul.008G033200.1Phvul.008G033000.1Phvul.004G049400.1
Phvul.004G049200.1
Picea abiesMA_10050955g0010MA_28794g0010MA_18557g0010MA_10435904g0010MA_17399g0010
Populus trichocarpaPotri.004G105300.1
Prunus persicappa001976mppa019057mppa023327mppa025396mppa022822m
ppa018031m
Ricinus communis27469.m00016529980.m00017535080.m000014
Setaria italicaSi029037m
Selaginella moellendorffii10094297501
Sorghum bicolorSb02g023660.1Sb10g001930.1
Thellungiella halophilaThhalv10012764mThhalv10003773m
Vitis viniferaGSVIVT01036466001
Volvox carteriVocar20013899m.72.571Vocar20013899m.72.571
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)