y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g38866.1
FamilyGT77
Protein PropertiesLength: 1660 Molecular Weight: 184158 Isoelectric Point: 6.8518
ChromosomeChromosome/Scaffold: 08 Start: 38092073 End: 38107120
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT77141416340
  IENFVVCALDKETSQFSILQGIPVFTDPIAPSNISFDDCHFGTKCFQRVTKVKSRIVLKILKLGYNVLLSDVDVYWFKNPVPLLHSLGPAVLAAQSDEYQ
  NQGPINLPRRLNSGFYYARSDSQTIAAIEKVVRHAETSGLSEQPSFYDTLCGNGGSNRVGDDKCVEPETNLTVHFLDRDLFANGAYQDLWREKNVKEACL
  KKGSYIIHNNWISGRLKKLER
Full Sequence
Protein Sequence     Length: 1660     Download
MDSFQQQPHG YMRPPQPPPL PPHTADPHHH PHHFHQIPPP PPQVPWFSSQ FQYRPSQTPS    60
PPPQWQQPPP APPSNAYSYH PNQFPPPRAH VPPPQFTPHS HVPPQPYPQE WGNPNWPPNQ    120
GYPANKNEDW AAKARAWADA NAARESQHPQ SHFSPAGRMQ EQSHYHDQYQ LSVDSHYTDV    180
QNQTHPSASY QQFSYLDASV QRISGHSQEP ASASLEASYN QDGHSCSARN GTGIGDSTVS    240
FEQGNLPTNP SVHQQEVPSS YSSVAGKEAA EQIQQSYSAF PLSSSSSQEH HVQPSMHAPP    300
FASGCHSVDS AISLADQPLD FAPRFNRDSD LQMQSTYSHH DSSSSMNNWV SPVAPGVGYP    360
PIPPILSSGQ QHDPSITTPG HVAPPFGRFP GPGLPSTIQP TGAPFTLSTG TTIHPTVAFS    420
ADVYGVSGIP DRPKKASVPN WLKDEIKKKV IPAPAGNLKE ETFVNDGIDK SYARGDEADS    480
KSIDSSRSAE DEEDEEVTDE LFDEIATKVL AEDDFTAEVG HKVATSNHKA SASPPSATVP    540
KASAKVFVPI KEKVENVDAS EKSNSSSPGD VLGLGNYGSD ADDGDNEIES SSVPTPAKDA    600
AYKSGIKKPL SDTHDLSVNG ISQLDEHAIS ETNLVNNQVK TISLPSRSSN GAATDQLHDD    660
KVTKESNHSH SSKVVSEDLR DNGLNFIERN HDRFNGFSSK DTSGIPRSEL PGKNISVEKA    720
MDDHSGRESR KKSEKNDRPD RSTSEKDFVK EVHSSKTKID EKGNENQRRK DERNQKRDKT    780
DYGSEAKERV KQHSLRHGEK AKESDSRKRS SHVDVKDDKK EAEKSHRGSA TDDTSRKREH    840
AKDKGEHKSR QKDASNNDRH RRRRSSSVSS RGRTKKDCIN HAGDSSGEGS DGSKRKLHSR    900
KRDLSPSPVR SKRSTVVSFL DNFCGLLIAS VLSAGILPIL LLILPGEGGQ DPDHLFGGRD    960
EWMGTEMVDF ASTVFIQENI NLEACTLEEA NVLVTSDYST CLNSGLGSQV ELWLVWLSGF    1020
AFISLSLYAT QRLSSLKDHT RTFKNAILDS TSLSNITIFT APKPFKGSIR TRQTLAIRSW    1080
LALSPYVTVV LFSQDPSVSS FADAFDSRVL VDTNIDFTFL GTPFFHSMVA KSRSYTSEIS    1140
VIIDSETVIL SGFISTLNHV YQLDHDWLLV ASAQNLQKIL QHNWQGKHCC YSRMLMVWNN    1200
KDAPLHSGVL PPFLYGKGTH NNWLIHEAMS SEFRFVFDAS LTITSFHLNE EDDFSPTHGN    1260
SSAVDIENRS WEYIGNSHIG ANYGSFFYSE ANFTSLVKLL KCNKQYIMVD TKKNIVYPIG    1320
HQGAMNLMKE KVIPSWLKEN TVYCIDRLNS HTKSLDCSVK DQTKIPSILE LPFSLESLLS    1380
ITSDKTKTVI LTVAGYSYKD MLMSWVCRLR KLSIENFVVC ALDKETSQFS ILQGIPVFTD    1440
PIAPSNISFD DCHFGTKCFQ RVTKVKSRIV LKILKLGYNV LLSDVDVYWF KNPVPLLHSL    1500
GPAVLAAQSD EYQNQGPINL PRRLNSGFYY ARSDSQTIAA IEKVVRHAET SGLSEQPSFY    1560
DTLCGNGGSN RVGDDKCVEP ETNLTVHFLD RDLFANGAYQ DLWREKNVKE ACLKKGSYII    1620
HNNWISGRLK KLERQVLSGL WEYDPSTRMC LRCSQCIKQ*                          1680
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PTZ00121PTZ001210.009718856142+
PTZ00121PTZ001210.006718854139+
PTZ00121PTZ001210.002688853172+
pfam03407Nucleotid_trans2.0e-4814141635223+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAG52325.10112816511535AC011663_4 hypothetical protein; 72471-70598 [Arabidopsis thaliana]
EMBLCAN65937.10112816551538hypothetical protein [Vitis vinifera]
EMBLCBI18645.10102116555611unnamed protein product [Vitis vinifera]
RefSeqXP_002271910.10112816551555PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.10112816521551predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7811205032607350
EL342448254140216550
EX136452310129516030
EL354468269138316510
HO781120557357898e-16
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma18g20856.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny