y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g42150.1
FamilyGT48
Protein PropertiesLength: 1922 Molecular Weight: 223453 Isoelectric Point: 8.072
ChromosomeChromosome/Scaffold: 08 Start: 42088276 End: 42113039
Descriptionglucan synthase-like 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48104517740
  VPQNIEARRRITFFANSLFMNMPKAPKVRDMLSFSVLTPYFKEDVLYSDEELNKENEDGISILFYLKKIYPDEWANFNERVKSDYLEEDKELIRQWASYR
  GQTLYRTVRGMMYYWQALILQYFIESAGDNALSEGYRTMDSYEKNKKLLEEAQAMADLKFTYVVSCQVYGSQKKSKNTRDRSCYTNILSLMLTHSALRVA
  YIDETEDTKDGKSQKVYYSVLVKGGDKYDEEIYRIKLPGPPTEIGEGKPENQNHAIVFTRGEALQTIDMNQDNYYEEAFKMRNVLEEFRRGRSGQRTPSI
  LGIREHIFTGSVSSLAWFMSNQETSFVTIGQRILANPLRVRFHYGHPDIFDRLFHITRGGISKASKVINLSEDIFAGFNSTLRQGYITHHEYIQVGKGRD
  VGMNQISLFEAKVANGNGEQTLSRDVYRLGRRFDFYRMLSFYFTTVGFYFSSMITVLTVYVFLYGRLYMVLSGVEREILQSPNMHQSKALEEALATQSVV
  QLGLLLVLPMVMEIGLEKGFRTALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHGGSKYRPTGRGFVVFHAKFADNYRMYSRSHFVKGLEILILLIVY
  EVYGSSYRSSHLYLFITISMWFLATSWLFAPFLFNPSGFDWQKTVDDWTDWKRWMGNRGGIGISSDKSWESWWDEENEHLKYSNLRGKIIEIILAFRFFM
  YQYGIVYHMDITHHNKDLLVFGLSWAVLVI
Full Sequence
Protein Sequence     Length: 1922     Download
MASTSGTKGG PFEMGRQPSK RMVRAPTRNV ELGNDEGVVD SEIVPSSLAV LVPILRAALE    60
IEEENPRVAY LCRFHAFEKA HTMDPTSSGR GVRQFKTYLL HKLEKEGELT EKSVQRSDAR    120
ELQTYYQHFY EKKIRDGEFS QRPEEMAKNV QIATVLYEVL KTMVAPQNTE DKTRRYAEDV    180
EHKRGQYEHY NILPLYAVGV KPAIMELPEI KAAIAALCRV DNLPMPIIRA RPDASQDDST    240
MPTDRLKKVN DILDWIASVF GFQKGNVANQ REHLILLLAN INIRDRPEPS YQLHVETIEK    300
LVGKIFKNYE SWCHYVRCES NLRYLEDYDL QQIELIYIAL YLLIWGEASN IRFMPECLCY    360
IFHHMCHEVY NILDKNLARV TGSTDLVEGR DDEHFLREVI TPIYQVLMKE AKRNNKGKAS    420
HSNWRNYDDL NEYFWSKKCF DDLSWPLNSK ADFFRHSDET QTRRRGRSHA NTAVGKRKPK    480
TNFVEVRTFL HLYRSFDRMW IFFILALQAM IIIAWSSLGP VGFFFDGDVF RNVMTIFITY    540
AFLNFLQVTL DIILTWNALK NMKFTQLLRY FLKFVVAAVW VVVLPVCYSS SQVNPSGLIR    600
FVTSWAGDWG NQSLYTYVVV LYMLPNIVAA ILFFLPPLRR KLERSNMRIL TFLMWWAQPK    660
LYVGRGMHEN MFSLLKYTLF WIMLLISKLA FSYYVEISPL VGPTKLIMGM SIDNYQWHEF    720
FPENETHNIC IVIAIWAPIM LVYFMDAQIW YAIYATLFGG IIGAFSHLGE IRTLGMLRSR    780
FQSVPIAFSQ RFWTGRDRKT KQEESDETYE RQNIAYFSQV WNEFINSMRE EDLISDRDRD    840
LLLVPYSSSY VSVIQWPPFL LASKIPIAVD MAKDYKKETD DDLVRKIKSD GYMYSAVVEC    900
YETLRDIILN LLLDEDDRRV VMRICGRVEE CIHEEKFVKE FNMSGLPSLS EKLEKFLTLL    960
RSEDGKLESQ IVNVLQDIVE IIIQDVMFDG HLLLQTPQQT PHEYHVERGQ KFVNIDTSFT    1020
HNTSVMEKVI RLHLLLTVKE SAINVPQNIE ARRRITFFAN SLFMNMPKAP KVRDMLSFSV    1080
LTPYFKEDVL YSDEELNKEN EDGISILFYL KKIYPDEWAN FNERVKSDYL EEDKELIRQW    1140
ASYRGQTLYR TVRGMMYYWQ ALILQYFIES AGDNALSEGY RTMDSYEKNK KLLEEAQAMA    1200
DLKFTYVVSC QVYGSQKKSK NTRDRSCYTN ILSLMLTHSA LRVAYIDETE DTKDGKSQKV    1260
YYSVLVKGGD KYDEEIYRIK LPGPPTEIGE GKPENQNHAI VFTRGEALQT IDMNQDNYYE    1320
EAFKMRNVLE EFRRGRSGQR TPSILGIREH IFTGSVSSLA WFMSNQETSF VTIGQRILAN    1380
PLRVRFHYGH PDIFDRLFHI TRGGISKASK VINLSEDIFA GFNSTLRQGY ITHHEYIQVG    1440
KGRDVGMNQI SLFEAKVANG NGEQTLSRDV YRLGRRFDFY RMLSFYFTTV GFYFSSMITV    1500
LTVYVFLYGR LYMVLSGVER EILQSPNMHQ SKALEEALAT QSVVQLGLLL VLPMVMEIGL    1560
EKGFRTALGD FIIMQLQLAS VFFTFQLGTK AHYYGRTLLH GGSKYRPTGR GFVVFHAKFA    1620
DNYRMYSRSH FVKGLEILIL LIVYEVYGSS YRSSHLYLFI TISMWFLATS WLFAPFLFNP    1680
SGFDWQKTVD DWTDWKRWMG NRGGIGISSD KSWESWWDEE NEHLKYSNLR GKIIEIILAF    1740
RFFMYQYGIV YHMDITHHNK DLLVFGLSWA VLVIILIVLK MVSMGRRRFG TDFQLMFRIL    1800
KALLFLGFLS VMTVLFVVCG LTIADLFAAI IAFMPSGWAI ILIAQACKVC LKGAKLWDSV    1860
KELSRAYEYV MGLIIFLPTA ILSWFPFVSE FQTRLLFNQA FSRGLQISMI LAGKKDTYKS    1920
D*                                                                   1980
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6051.0e-651178138+
pfam14288FKS1_dom17.0e-47345446102+
pfam02364Glucan_synthase010451761796+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_191469.202192031931ATGSL11 (glucan synthase-like 11); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Swiss-ProtQ9LYS602192031918CALS6_ARATH RecName: Full=Putative callose synthase 6; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 11
RefSeqXP_002300874.101192111921predicted protein [Populus trichocarpa]
RefSeqXP_002307554.101191611928predicted protein [Populus trichocarpa]
RefSeqXP_002526651.101191611902transferase, transferring glycosyl groups, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
499521
536558
571593
613635
673695
725744
749771
14851507
16291651
16561678
17331750
17651782
18021824
18281845
18661888
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519626129419150
HO780746512107515750
HO780496339134916870
HO780496132123013480
HO780496204167618780
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma18g12870.3Glyma18g12870.2
Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1Glyma15g42330.4
Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1Glyma08g47670.2
Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6Glyma18g13105.10
Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5Glyma18g13105.4
Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5Glyma08g42110.1
Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4Glyma10g44150.2
Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)