y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g42730.1
FamilyCE10
Protein PropertiesLength: 682 Molecular Weight: 75498.9 Isoelectric Point: 4.9917
ChromosomeChromosome/Scaffold: 08 Start: 42711062 End: 42724425
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE104376545.5e-27
  QASEEEKPPLLLKSHGGPTAETRGILNLSIQYWTSRGWAFVDVNYGGSTGYGREFRERLLGRWGIVDVNDCCSCATYLVNSGKVDGERLCITGGSAGGYT
  TLAALAFKETFKAGASLYGVADVNMLRAETHKFESHYIDRLGGGEKGCYERSPINHVDKFSCPIILFQGLDDKVVPPEQARKIYQALKEKGVPVALVEYE
  GEQHGFRKAENIKFTLEQ
Full Sequence
Protein Sequence     Length: 682     Download
MASSAATTIP SLSERITAPY GSWKSPITTD VVSGASKRLG GTAVDGRGRL IWLESRPAES    60
GRGVLVVEPE NPGGEAVDIT PKEFGVRTVA QEYGGGAFTV SGDVVFFANY KDQRLYKQSI    120
SSLDVPPIPL TPDYGGPVVS YADGILDVRF NRFISVREDR CESSQNPTTT IVSIALGSKD    180
AQEPQVLVGG SDFYAFPRLD PKSERMAWIQ WSHPNMPWDK SELWVGYISE NGEIYKRVCV    240
AGNNPSLVES PTEPKWSSDG ELFFITDREN GFWNLHKWIE SENKVLPVYS LEAEFARPLW    300
IFGMNSYEFL QSHTRKNLIA CSYRQQGKSY LGIIDDVKGS KLTVLDIPFT DIDNITSSNN    360
YLFVEGASAV HPSSVAKVTL DNDKSKAVDF NIIWSSSPDS LKYSSYFSKP ELIEFPTEVP    420
GQNAYAYFYP PTNPDFQASE EEKPPLLLKS HGGPTAETRG ILNLSIQYWT SRGWAFVDVN    480
YGGSTGYGRE FRERLLGRWG IVDVNDCCSC ATYLVNSGKV DGERLCITGG SAGGYTTLAA    540
LAFKETFKAG ASLYGVADVN MLRAETHKFE SHYIDRLGGG EKGCYERSPI NHVDKFSCPI    600
ILFQGLDDKV VPPEQARKIY QALKEKGVPV ALVEYEGEQH GFRKAENIKF TLEQQMVFFA    660
RLVGHFNVAD DINPIKIDNF D*                                             720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes2.0e-7504642163+
COG1505COG15058.0e-9440641214+
COG0412COG04121.0e-11410642243+
pfam00326Peptidase_S94.0e-49466664204+
COG1506DAP22.0e-69186666491+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_198470.301768169729serine-type peptidase [Arabidopsis thaliana]
RefSeqXP_002284254.1016813677PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002284264.1016811675PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302446.1016811672predicted protein [Populus trichocarpa]
RefSeqXP_002510270.10568052730acylamino-acid-releasing enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3azo_B0176644649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A0176644649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_B0176644649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_A0176644649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azp_B0176644649A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7802165431426820
DV7110393083496560
DV7111723023496500
FG8473142404236620
HO8002592354486820
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma18g11480.3Glyma18g11480.2Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)