y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g45210.1
FamilyGT35
Protein PropertiesLength: 847 Molecular Weight: 95827 Isoelectric Point: 6.3871
ChromosomeChromosome/Scaffold: 08 Start: 44622012 End: 44630245
Descriptionalpha-glucan phosphorylase 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351218410
  ALRKFGLELEEIAEQEKDAALGNGGLGRLASCFLDSMATLNLPSWGYGLRYRYGLFKQRITREGQEEVAEDWLEKFSPWEVVRHDILYPIRFFGHVEVNP
  DGSRKWVGGEVVQALAYDVPIPGYQTKNTISLRLWEAKASAEDFNLFLFNDGQHDAASVLHSRAQQICAVLYPGDTTEGGKLLRLKQQFFLCSASLQDII
  SRFKERRQGPWNWSEFPTKVAVQLNDTHPTLAIPELMRLLMDDEGLGWDEAWDVTSKTIAYTNHTVLPEALEKWSQPVMWKLLPRHMEIIQEIDKRFTAM
  INTTRLDLENELSAMRILDDNPQKPVVRMANLCVVSSHAVNGVAQLHSDILKSELFANYVSIWPTKFQNKTNGITPRRWLQFCNPELGGIITKWLKTDKW
  VTNLDLLTGLRQFADNEDLQAEWLSAKMASKQRLARYVLQVTGESIDPDTLFDIQVKRIHEYKRQLLNILGVIYRYKKLKEMSLEERKNTTPRTVMIGGK
  AFATYTNAIRIVRLVNDVGAVVNSDPEVNGYLKVVFVPNYNVSVAEVLIPGSELSQHISTAGMEASGTSNMKFALNGCLIIGTLDGANVEIREEIGEDNF
  FLFGATAEDVPRLRKERENGLFKPDPRFEEAKKFIRSGVFGSYDYNPLLESLEGNSGYGRGDYFLVGHDFPSYMDTQAKVDEAYRDRKRWLKMSILSTAG
  SGKFSSDRTIAQYAKEIWNIE
Full Sequence
Protein Sequence     Length: 847     Download
MAAKVDANGG GGKGGVSAVS AKVPAVAHPL AEKPDEVASN ISYHAQFSPH FSPFKFELEQ    60
AYYATAESVR DRLIRQWNET YLHFHKVDPK QTYYLSMEFL QGRALTNAIG NLNIQDAYAN    120
ALRKFGLELE EIAEQEKDAA LGNGGLGRLA SCFLDSMATL NLPSWGYGLR YRYGLFKQRI    180
TREGQEEVAE DWLEKFSPWE VVRHDILYPI RFFGHVEVNP DGSRKWVGGE VVQALAYDVP    240
IPGYQTKNTI SLRLWEAKAS AEDFNLFLFN DGQHDAASVL HSRAQQICAV LYPGDTTEGG    300
KLLRLKQQFF LCSASLQDII SRFKERRQGP WNWSEFPTKV AVQLNDTHPT LAIPELMRLL    360
MDDEGLGWDE AWDVTSKTIA YTNHTVLPEA LEKWSQPVMW KLLPRHMEII QEIDKRFTAM    420
INTTRLDLEN ELSAMRILDD NPQKPVVRMA NLCVVSSHAV NGVAQLHSDI LKSELFANYV    480
SIWPTKFQNK TNGITPRRWL QFCNPELGGI ITKWLKTDKW VTNLDLLTGL RQFADNEDLQ    540
AEWLSAKMAS KQRLARYVLQ VTGESIDPDT LFDIQVKRIH EYKRQLLNIL GVIYRYKKLK    600
EMSLEERKNT TPRTVMIGGK AFATYTNAIR IVRLVNDVGA VVNSDPEVNG YLKVVFVPNY    660
NVSVAEVLIP GSELSQHIST AGMEASGTSN MKFALNGCLI IGTLDGANVE IREEIGEDNF    720
FLFGATAEDV PRLRKERENG LFKPDPRFEE AKKFIRSGVF GSYDYNPLLE SLEGNSGYGR    780
GDYFLVGHDF PSYMDTQAKV DEAYRDRKRW LKMSILSTAG SGKFSSDRTI AQYAKEIWNI    840
EECRVP*                                                              900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04300GT1_Glycogen_Phosphorylase038840811+
TIGR02093P_ylase041840808+
pfam00343Phosphorylase0121842727+
COG0058GlgP033841813+
PRK14985PRK14985094838755+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAG31926.1038462843alpha-1,4-glucan phosphorylase H isozyme [Cucurbita maxima]
Swiss-ProtP53537018461842PHSH_VICFA RecName: Full=Alpha-glucan phosphorylase, H isozyme; AltName: Full=Starch phosphorylase H
RefSeqXP_002280732.1018461843PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002313399.1038464853predicted protein [Populus trichocarpa]
RefSeqXP_002520435.1018461849glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ygp_B06184168876A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1ygp_A06184168876A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1z8d_A06284453832A Chain A, Crystal Structure Of Human Muscle Glycogen Phosphorylase A With Amp And Glucose
PDB2gj4_A03184410820A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
PDB4el5_A06284441820A Chain A, Structure Of Rabbit Muscle Glycogen Phosphorylase In Complex With Ligand
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1826EC-2.4.1.1phosphorylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7822004101775860
HO4180365402477620
HO801570317283440
HO8014682901944830
HO801468111841940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma18g07480.1Glyma20g03250.4.554.965Glyma20g03250.4.554.965
Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973Glyma13g06040.1
Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493Glyma20g03250.3.169.493
Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)