y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma08g47410.2
FamilyAA1
Protein PropertiesLength: 441 Molecular Weight: 48810.3 Isoelectric Point: 9.2385
ChromosomeChromosome/Scaffold: 08 Start: 46272521 End: 46275117
Descriptionlaccase 17
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1212360
  YHFDVSRLYHTKSMVTVNGQFTGPRIVAREGDRLLIKVINHVQNNISIHWHGIQQLQSGWADGPAYVTQCPIQIGQSYVYNYTIGGQRGTLFWHAHISWL
  RSTLCDPIIILPKHGVPYPFTKPYKEVSIIFGEWWNADPEAVITQALQIGGGPNVSDAYTINGLPGPLYNYTFKLKVKPTKTYLLGLINAALNDKLFFSI
  ANHTFTVVDVDAIYTI
Full Sequence
Protein Sequence     Length: 441     Download
MLLFSLIIIP QLALGGITRH YHFDVSRLYH TKSMVTVNGQ FTGPRIVARE GDRLLIKVIN    60
HVQNNISIHW HGIQQLQSGW ADGPAYVTQC PIQIGQSYVY NYTIGGQRGT LFWHAHISWL    120
RSTLCDPIII LPKHGVPYPF TKPYKEVSII FGEWWNADPE AVITQALQIG GGPNVSDAYT    180
INGLPGPLYN YTFKLKVKPT KTYLLGLINA ALNDKLFFSI ANHTFTVVDV DAIYTICDWP    240
GHSLHSTSSI KKLSLFKPIL PSLNDTSFST NFANNLRSLA SAQPWHNSCP RNQTCQGPTN    300
STKFAASVNN ISFIQPTTAL LQTHFFGQSN GVYTPDFPTK TLVPFNYTGT PPNNTMVSNG    360
TKVVVLPFNT SVELVMQDTS ILGAESHPLH LHVFNFLLLV KDLGTLIQIR TLQTSILLIL    420
LKGTQLVSHL GMGCCQIPSR *                                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02604PLN026042.0e-291234265+
PLN02191PLN021911.0e-2919388454+
TIGR03388ascorbase8.0e-3818388458+
pfam07732Cu-oxidase_31.0e-4324135114+
TIGR03389laccase016388444+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN80346.10440420503hypothetical protein [Vitis vinifera]
EMBLCBI16199.1044041484unnamed protein product [Vitis vinifera]
EMBLCBI16224.10540421503unnamed protein product [Vitis vinifera]
RefSeqXP_002284473.10540421503PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299296.10140614501predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3kw7_B6e-252423314226A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2
PDB3kw7_A6e-252423314226A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2
PDB1asq_B1e-24193994457A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2
PDB1asq_A1e-24193994457A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2
PDB1asp_B1e-24193994457A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2
Signal Peptide
Cleavage Site
15
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC885679232122340
FC884139232122340
DY269298232122340
DY273426232122340
DY97123923682340
Orthologous Group
SpeciesID
Brassica rapaBra005140.25.269Bra005140.25.269Bra005698.25.285Bra005698.25.285
Carica papayaevm.model.supercontig_139.15.34.255evm.model.supercontig_139.15.34.255evm.model.supercontig_169.17.31.279evm.model.supercontig_169.17.31.279evm.model.supercontig_19.219
Citrus sinensisorange1.1g008592m.37.264orange1.1g008592m.37.264
Fragaria vescamrna25266.1-v1.0-hybrid
Gossypium raimondiiGorai.013G036000.1Gorai.009G103600.1.32.259Gorai.009G103600.1.32.259
Malus domesticaMDP0000192322.23.258MDP0000126274.23.271MDP0000126274.23.271MDP0000192322.23.258MDP0000226556.23.258
MDP0000226556.23.258
Panicum virgatumPavirv00001051mPavirv00052717mPavirv00016758mPavirv00052149m
Phaseolus vulgarisPhvul.008G100600.1.29.296Phvul.008G100600.1.29.296
Picea abiesMA_11289g0010MA_785232g0010MA_10433581g0010MA_21316g0010.22.258MA_21316g0010.22.258
MA_110005g0010
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny