y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g00841.1
FamilyPL1
Protein PropertiesLength: 241 Molecular Weight: 26464.3 Isoelectric Point: 9.1347
ChromosomeChromosome/Scaffold: 09 Start: 457294 End: 459159
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1272250
  IQKQTLCIIFAKDMVIRLKNELIMNSYKTIDGRGAKVEIANRPCITIQGVSHVIMHGIKIHDCKPSKVGLVRSTQSHLCSDGDGIGIFASSNVWIDHCFL
  ARCADGLIDVIHASTSITISNNYFTQHDRLAIPSSLSFVYAVSFSSFNRFASGLIERMPRVRFGYAHVVNNKYDGWKMYAIGGSSNPTILSEGNYYVAP
Full Sequence
Protein Sequence     Length: 241     Download
YGSIYKVTDP LDDPISPKTG TLHYGVIQKQ TLCIIFAKDM VIRLKNELIM NSYKTIDGRG    60
AKVEIANRPC ITIQGVSHVI MHGIKIHDCK PSKVGLVRST QSHLCSDGDG IGIFASSNVW    120
IDHCFLARCA DGLIDVIHAS TSITISNNYF TQHDRLAIPS SLSFVYAVSF SSFNRFASGL    180
IERMPRVRFG YAHVVNNKYD GWKMYAIGGS SNPTILSEGN YYVAPNNPAT KQVRKGISSE    240
*                                                                    300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-1852222188+
pfam00544Pec_lyase_C4.0e-4745222213+
smart00656Amb_all9.0e-6339226208+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI23207.10123537279unnamed protein product [Vitis vinifera]
RefSeqNP_172656.10123972318pectate lyase family protein [Arabidopsis thaliana]
Swiss-ProtO653880123372312PEL2_ARATH RecName: Full=Putative pectate lyase 2; Flags: Precursor
RefSeqXP_002263615.10123586328PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002518442.10123579321Pectate lyase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0224038286A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0224038286A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB3zsc_A0.00000000000004107224115248A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB1vbl_A0.00000000158222140330A Chain A, Structure Of The Thermostable Pectate Lyase Pl 47
PDB1pcl_A0.0000000024322671280A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EC87855224722390
CO10239224722390
CA785370230142350
GT74003124522350
DT57465924322350
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00377.2Aquca_011_00377.1Aquca_056_00058.1Aquca_034_00209.3Aquca_034_00209.1
Aquca_108_00001.2Aquca_108_00001.1Aquca_034_00209.2Aquca_038_00141.1Aquca_030_00036.1
Aquca_011_00023.1Aquca_070_00020.1Aquca_011_00011.1Aquca_066_00046.1Aquca_074_00067.1
Aquca_002_00501.1Aquca_038_00142.2Aquca_038_00142.1
Arabidopsis lyrata496502475879478021495658355442
887643492364898940487211494953
333008899063485694865133312221
492665485907471616488352477401
484177
Arabidopsis thalianaAT5G63180.1AT1G67750.1AT3G07010.1AT5G55720.1AT1G04680.1
AT4G13710.2AT4G13710.1AT3G24670.1AT4G24780.2AT4G24780.1
AT3G24230.1AT5G04310.1AT5G48900.1AT4G13210.2AT4G13210.1
AT3G53190.1AT3G27400.1AT4G22090.1AT3G54920.1AT4G22080.1
AT1G11920.1AT1G14420.1AT3G01270.1AT5G15110.1AT2G02720.1
Brachypodium distachyonBradi5g01135.1Bradi3g27926.1Bradi1g37280.1Bradi3g08035.1
Brassica rapaBra019209Bra035852Bra038614Bra004073Bra010482
Bra013833Bra036155Bra035588Bra004254Bra015000
Bra030583Bra032494Bra015341Bra032730Bra040809
Bra032696Bra033980Bra020672Bra009469Bra015070
Bra005799Bra003200Bra007116Bra028549Bra039081
Bra006976Bra029614Bra025274Bra013585Bra020859
Bra026832Bra001011Bra026221Bra019729Bra016700
Bra019730Bra017412Bra023504Bra033008Bra006279
Bra008721Bra026583Bra024811
Carica papayaevm.model.supercontig_4.36evm.model.supercontig_59.92evm.model.supercontig_33.89evm.model.supercontig_8.183evm.model.supercontig_53.152
evm.model.supercontig_92.98evm.model.supercontig_17.208evm.model.supercontig_152.39evm.model.supercontig_14.39evm.model.supercontig_862.2
evm.model.supercontig_5.270
Capsella rubellaCarubv10026494mCarubv10020387mCarubv10013945mCarubv10013802mCarubv10027870m
Carubv10009197mCarubv10004942mCarubv10004736mCarubv10013661mCarubv10000891m
Carubv10000723mCarubv10026482mCarubv10006630mCarubv10013715mCarubv10017111m
Carubv10017351mCarubv10007804mCarubv10017065mCarubv10011187mCarubv10012514m
Carubv10018855mCarubv10002862mCarubv10016149m
Citrus clementinaCiclev10008571mCiclev10020423mCiclev10031429mCiclev10019202mCiclev10004845m
Ciclev10004783mCiclev10015474mCiclev10031337mCiclev10011635mCiclev10017878m
Ciclev10020193mCiclev10011763mCiclev10011762mCiclev10013750mCiclev10031653m
Citrus sinensisorange1.1g016398morange1.1g019664morange1.1g015569morange1.1g023995morange1.1g019799m
orange1.1g015702morange1.1g013239morange1.1g010437morange1.1g015685morange1.1g023976m
orange1.1g015623morange1.1g018853morange1.1g014647morange1.1g011204morange1.1g011814m
orange1.1g047672morange1.1g013757morange1.1g023251morange1.1g023390morange1.1g044170m
orange1.1g036607m
Cucumis sativusCucsa.391620.1Cucsa.194310.1Cucsa.256180.2Cucsa.256180.1Cucsa.140360.1
Cucsa.186200.1Cucsa.394640.2Cucsa.308710.1Cucsa.011030.1Cucsa.124770.1
Cucsa.045020.1Cucsa.005440.1Cucsa.085530.1Cucsa.285320.1Cucsa.097920.1
Cucsa.339080.1Cucsa.394640.1
Eucalyptus grandisEucgr.C02252.1Eucgr.F02050.1Eucgr.H02448.1Eucgr.B00168.1Eucgr.K03600.1
Eucgr.H02860.2Eucgr.H02860.1Eucgr.G02887.1Eucgr.G02748.1Eucgr.H00093.2
Eucgr.H00093.1Eucgr.G02748.2Eucgr.J02266.1Eucgr.D01352.1Eucgr.G02541.1
Eucgr.G02162.1Eucgr.J02132.1
Fragaria vescamrna10004.1-v1.0-hybridmrna24370.1-v1.0-hybridmrna17555.1-v1.0-hybridmrna23429.1-v1.0-hybridmrna09684.1-v1.0-hybrid
mrna27998.1-v1.0-hybridmrna16611.1-v1.0-hybridmrna19480.1-v1.0-hybridmrna25949.1-v1.0-hybridmrna01266.1-v1.0-hybrid
mrna19804.1-v1.0-hybrid
Glycine maxGlyma05g02890.1Glyma17g13550.2Glyma17g13550.1Glyma04g36520.1Glyma06g18370.1
Glyma18g01560.1Glyma19g07490.1Glyma11g37610.1Glyma20g19200.1Glyma05g23950.1
Glyma18g38430.1Glyma08g47161.1Glyma10g24630.1Glyma03g34260.1Glyma15g11700.1
Glyma13g20890.1Glyma20g24670.1Glyma10g42390.1Glyma17g01470.2Glyma09g00850.1
Glyma19g02390.1Glyma08g40820.2Glyma01g04970.1Glyma18g01570.2Glyma13g05150.1
Glyma11g37620.1Glyma02g02460.1Glyma04g34260.2Glyma18g49090.1
Gossypium raimondiiGorai.009G450300.1Gorai.008G162500.2Gorai.003G108300.1Gorai.008G162500.1Gorai.008G203900.2
Gorai.008G203900.1Gorai.001G062400.1Gorai.006G219800.2Gorai.006G219800.1Gorai.011G161900.1
Gorai.001G267300.1Gorai.007G152500.1Gorai.009G339700.1Gorai.008G203900.4Gorai.005G174600.2
Gorai.005G174600.1Gorai.006G036300.1Gorai.006G219800.4Gorai.002G189900.1Gorai.001G184600.1
Gorai.009G309900.1Gorai.009G309900.2Gorai.002G246200.1Gorai.011G012500.1Gorai.010G207200.3
Gorai.010G207200.1Gorai.010G207200.4Gorai.010G182700.1Gorai.002G246200.2Gorai.009G439300.1
Gorai.009G438700.1Gorai.003G094800.1Gorai.003G108300.2Gorai.008G203900.3Gorai.006G219800.3
Gorai.002G064100.1Gorai.005G174600.3Gorai.006G024800.1Gorai.012G187800.1Gorai.005G227000.1
Gorai.007G265100.1Gorai.009G334700.1Gorai.007G078600.1Gorai.N020100.1Gorai.N020200.1
Gorai.009G334500.1Gorai.009G334800.1Gorai.N020300.1Gorai.013G077600.2Gorai.013G077600.1
Gorai.013G078300.1Gorai.013G078500.1Gorai.013G078000.1Gorai.010G207200.2Gorai.009G334600.1
Linum usitatissimumLus10036946Lus10033037Lus10006456Lus10011400Lus10011758
Lus10022817Lus10011885Lus10023679Lus10038157Lus10022310
Lus10014887Lus10014414Lus10023542Lus10013667Lus10006241
Lus10023917Lus10037945.486.691Lus10037945.486.691Lus10011258Lus10011257
Lus10018430Lus10018429Lus10005254Lus10013668Lus10036721
Lus10030791Lus10037207Lus10023623Lus10030670Lus10033018
Lus10015359Lus10037945.136.295Lus10037945.136.295Lus10013267
Malus domesticaMDP0000394944MDP0000201389MDP0000718765MDP0000573746MDP0000631698
MDP0000491898MDP0000319156MDP0000277149MDP0000266603MDP0000285495
MDP0000145734MDP0000181608MDP0000302503MDP0000150610MDP0000133529
MDP0000276859MDP0000256522MDP0000232225MDP0000236210MDP0000289069
MDP0000205892MDP0000301545MDP0000518885MDP0000482731MDP0000701129
MDP0000454269MDP0000137872
Manihot esculentacassava4.1_033025mcassava4.1_008855mcassava4.1_009041mcassava4.1_009002mcassava4.1_008852m
cassava4.1_007737mcassava4.1_007840mcassava4.1_007516mcassava4.1_007568mcassava4.1_027215m
cassava4.1_006659mcassava4.1_029354mcassava4.1_006540mcassava4.1_022396mcassava4.1_006106m
cassava4.1_028711mcassava4.1_028419mcassava4.1_013270mcassava4.1_022024mcassava4.1_023546m
cassava4.1_020968m
Medicago truncatulaMedtr4g104320.1Medtr6g021950.1Medtr3g086310.1Medtr7g059290.1Medtr3g086320.1
Medtr6g045700.1Medtr4g132460.1Medtr7g009390.1Medtr5g038490.1Medtr5g038510.1
Medtr4g107870.1
Mimulus guttatusmgv1a007737mmgv1a007460mmgv1a007569mmgv1a007094mmgv1a006554m
mgv1a023431mmgv1a004990mmgv1a006198mmgv1a006571mmgv1a005520m
mgv1a006100mmgv1a024530mmgv1a008057mmgv1a006379mmgv1a006386m
mgv1a011674mmgv1a006498mmgv1a006496m
Oryza sativaLOC_Os04g05050.2LOC_Os04g05050.1LOC_Os10g31910.1LOC_Os06g05260.1LOC_Os02g12300.1
LOC_Os06g38510.2LOC_Os06g38510.1LOC_Os06g05272.1LOC_Os06g05209.1
Panicum virgatumPavirv00014056mPavirv00052749mPavirv00054428mPavirv00024398mPavirv00044587m
Pavirv00005788mPavirv00001518mPavirv00065339mPavirv00053507mPavirv00025288m
Physcomitrella patensPp1s563_1V6.3Pp1s563_1V6.2Pp1s563_1V6.1Pp1s355_16V6.1Pp1s67_160V6.1
Pp1s112_172V6.1Pp1s84_82V6.1Pp1s173_162V6.1Pp1s28_242V6.1Pp1s409_2V6.1
Pp1s92_84V6.1Pp1s92_82V6.1Pp1s204_112V6.1Pp1s206_50V6.1
Phaseolus vulgarisPhvul.003G207400.1Phvul.004G059200.1Phvul.009G170500.1Phvul.001G256900.1Phvul.007G236800.1
Phvul.008G123000.1Phvul.007G024400.1Phvul.001G180800.1Phvul.007G151200.1Phvul.006G147600.1
Phvul.003G081000.1Phvul.001G256800.1Phvul.006G147500.1Phvul.003G069100.1Phvul.004G026400.1
Phvul.009G125800.1Phvul.009G189800.1Phvul.002G065800.1Phvul.008G043600.1
Picea abiesMA_476625g0010MA_956526g0010MA_10437227g0020MA_91467g0010MA_10428603g0020
MA_97947g0010MA_10205415g0010MA_10353668g0010MA_928735g0010MA_10430145g0030
MA_203992g0010MA_103716g0010MA_10426822g0020MA_474372g0010MA_185203g0010
MA_66914g0010MA_10430145g0020MA_10437227g0030.141.319MA_10437227g0030.141.319MA_101171g0010
MA_6474333g0010MA_10437227g0030.312.446MA_10437227g0030.312.446
Populus trichocarpaPotri.004G007300.1Potri.011G093400.2Potri.011G093400.1Potri.001G367800.1Potri.015G087800.2
Potri.015G087800.1Potri.012G091500.2Potri.012G091500.1Potri.012G091300.1Potri.014G178100.2
Potri.014G178100.1Potri.002G238800.1Potri.001G052300.1Potri.003G175900.1Potri.008G182200.2
Potri.008G182200.1Potri.010G051800.2Potri.010G051800.1Potri.001G339500.2Potri.001G339500.1
Potri.006G122000.1Potri.008G032700.2Potri.008G032700.1Potri.010G229000.3Potri.010G229000.1
Potri.T040400.1Potri.011G008000.1Potri.010G229000.2Potri.T040300.1Potri.011G008100.1
Potri.015G064700.1Potri.017G078400.1Potri.008G148800.1Potri.004G124100.1
Prunus persicappa006392mppa006665mppa006229mppa005761mppa004881m
ppa006569mppa003600mppa005744mppa025559mppa019055m
ppa005859mppa005602mppa016012m
Ricinus communis29629.m00137629929.m00477329633.m00091330204.m00179630147.m013824
29904.m00299430078.m00225829898.m00006529842.m00355229842.m003553
29736.m00203230147.m014076
Setaria italicaSi010221mSi035441mSi006451mSi017224mSi006418m
Selaginella moellendorffii40749581909439243
Sorghum bicolorSb06g001410.1Sb01g020180.1Sb10g003080.1Sb10g003090.1Sb04g007450.1
Sb10g022830.1
Thellungiella halophilaThhalv10016093m
Vitis viniferaGSVIVT01014682001GSVIVT01007582001GSVIVT01000592001GSVIVT01003984001GSVIVT01028548001
GSVIVT01029048001GSVIVT01016208001GSVIVT01012679001GSVIVT01011348001GSVIVT01020068001
GSVIVT01016209001GSVIVT01020067001GSVIVT01008053001
Zea maysAC194852.3_FGT007
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)