y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g02350.2
FamilyGT65
Protein PropertiesLength: 439 Molecular Weight: 49819.9 Isoelectric Point: 8.5982
ChromosomeChromosome/Scaffold: 09 Start: 1571623 End: 1574470
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65723870
  GLNNQKIAFARACLTARLLNRTLLMPSLSASLFYKEIDLLQPISFDKVFQFEKFNALCRGFVRLGRYSDVLNRTEVLEMEKGSGRRWTVERDLSQLKEHS
  EGSFDDYEIIRIIGKNPFLWHDHWPVKDYARIFECLDLTEEIAKEADRVVSRIRAVGREVTGNTEAVEVKSSIITSDGSSFQPLPFVAVHMRIEIDWMIH
  CKNLERRLNTNRICSGKKAIVERVRNIAGLKTPVVVYLAVADKLLNNSSILDGWEEGFLPFEKKKLGVVGIYKKYPYLIQSAIDYEVCLKADIFVGNSFS
  TFSSLIVLERTQKMIR
Full Sequence
Protein Sequence     Length: 439     Download
MEVLAGALHS ITSKCMVLLV TVLILRALLF ASFPGFGGIE WGNLVYLRAP LLNFDFGIRQ    60
DKFLVVPQLV WGLNNQKIAF ARACLTARLL NRTLLMPSLS ASLFYKEIDL LQPISFDKVF    120
QFEKFNALCR GFVRLGRYSD VLNRTEVLEM EKGSGRRWTV ERDLSQLKEH SEGSFDDYEI    180
IRIIGKNPFL WHDHWPVKDY ARIFECLDLT EEIAKEADRV VSRIRAVGRE VTGNTEAVEV    240
KSSIITSDGS SFQPLPFVAV HMRIEIDWMI HCKNLERRLN TNRICSGKKA IVERVRNIAG    300
LKTPVVVYLA VADKLLNNSS ILDGWEEGFL PFEKKKLGVV GIYKKYPYLI QSAIDYEVCL    360
KADIFVGNSF STFSSLIVLE RTQKMIRMSV TNMCGENVRW PSYAYNIPGE SNGPMRWVTN    420
MSESSLQAIS YGTNHISC*                                                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.0002639735+
cd11302O-FucT-15.0e-678381372+
cd11299O-FucT_plant8.0e-1772382331+
cd11296O-FucT_like2.0e-21193382195+
pfam10250O-FucT4.0e-4172382342+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187183.301043816442unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.10114381427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321799.10894381347predicted protein [Populus trichocarpa]
RefSeqXP_002332132.10894381347predicted protein [Populus trichocarpa]
RefSeqXP_002531235.10843817446conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.00002256381212344A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB3zy5_A0.00002256381212344A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB3zy4_A0.00002256381212344A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB3zy3_B0.00002256381212344A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
PDB3zy3_A0.00002256381212344A Chain A, X-Ray Crystal Structure Of Tdp-Vancosaminyltransferase Gtfd As A Complex With Tdp And The Natural Substrate, Desvancosaminyl Vancomycin.
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW5174702691714390
HO0169931912144040
FK000039232402710
DW5173972521714220
GO8579223071324380
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma15g13250.1Glyma20g02800.2
Glyma20g02800.3Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378Glyma07g34965.3.189.378
Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189Glyma07g34965.3.70.189
Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny