y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g03110.1
FamilyAA7
Protein PropertiesLength: 394 Molecular Weight: 44077.5 Isoelectric Point: 8.5763
ChromosomeChromosome/Scaffold: 09 Start: 2193266 End: 2194744
DescriptionFAD-binding Berberine family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA7431730
  NNIKTRSGGHGFEGRSYISDEPFIMLDMFNLRNITVDVQNEVAVVQAGATLGEVYYRIWEKSDVHGFPAGECHTVGVGGHFGGGGYGNMMRKYGLSIDHI
  LDAKIVDVKSRILNKESMGEDLFWAIRGGGG
Full Sequence
Protein Sequence     Length: 394     Download
MEKPIPLATM LPIVIVYLFS LHASCAAPTT ESVHETFVDC LRNNIKTRSG GHGFEGRSYI    60
SDEPFIMLDM FNLRNITVDV QNEVAVVQAG ATLGEVYYRI WEKSDVHGFP AGECHTVGVG    120
GHFGGGGYGN MMRKYGLSID HILDAKIVDV KSRILNKESM GEDLFWAIRG GGGLHLVISN    180
VGERNKTVRA AVMTKFLGGT EELVSLLEKE LPTLGLKKEN CIEMSWIESA VWWDSFPNGA    240
HPEALLGRKL NSAKFLKRKS DYVKTPISKD GLEWIWKKMI ELRQTSMAFN PNDGRMNKIS    300
ANATAFPHRQ GNLFKIEYSV NWEEPGISAE KNFTIQIRRL HSYMTPFVSK NPRRAFLNYR    360
DLDIGINHHD NNSSTKKGGF MVLSTSITTS TDW*                                420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0277GlcD7.0e-740174147+
pfam01565FAD_binding_41.0e-1229156131+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN81650.10836681485hypothetical protein [Vitis vinifera]
RefSeqXP_002267223.10836681485PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002268606.10836681485PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299028.10836679484predicted protein [Populus trichocarpa]
RefSeqXP_002523158.1045373113494Reticuline oxidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4dns_B02837961459A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB4dns_A02837961459A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3tsj_B02837959459A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3tsj_A02837959459A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
PDB3tsh_A02837959459A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity
Metabolic Pathways
Pathway NameReactionECProtein Name
berberine biosynthesisRETICULINE-OXIDASE-RXNEC-1.21.3.3reticuline oxidase
dehydroscoulerine biosynthesisRETICULINE-OXIDASE-RXNEC-1.21.3.3reticuline oxidase
sanguinarine and macarpine biosynthesisRETICULINE-OXIDASE-RXNEC-1.21.3.3reticuline oxidase
Signal Peptide
Cleavage Site
26
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY290183364513590
HO7811533051303730
DY262774353873830
AM7322102001743730
CF5143882791313560