y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g05340.1
FamilyAA2
Protein PropertiesLength: 346 Molecular Weight: 39010.3 Isoelectric Point: 5.4035
ChromosomeChromosome/Scaffold: 09 Start: 4138807 End: 4140617
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2833252e-32
  LKDYTLAASLMRLHFHDCSVRGCDGSILLKHDGSERTAHASKTLRGFEVVDDIKAELEKQCPKTVSCADILTAAARDATFELRWALLGCSLWWEEWGKVS
  IAKEADMVPMGHENITSLIEFFQSRGMTRAHTIGRISCGSIQYRLYNNQGTGKPDPTLDPKYVNFLQSKCRWASEYVDLDATTPKTFDNVYYINLQKKMG
  LLSTDQLLYSDPRTSPLVSALIASHSVFEHQFAVSMGKLGIVD
Full Sequence
Protein Sequence     Length: 346     Download
MSNSFLSLLI LLVLYIFSAS AQPYEDYDDK SSLYPTKSDT VFSLEVPTLD ETTFDNLLSF    60
GYYRKTCPQF ESILHNKVKE WILKDYTLAA SLMRLHFHDC SVRGCDGSIL LKHDGSERTA    120
HASKTLRGFE VVDDIKAELE KQCPKTVSCA DILTAAARDA TFELRWALLG CSLWWEEWGK    180
VSIAKEADMV PMGHENITSL IEFFQSRGMT RAHTIGRISC GSIQYRLYNN QGTGKPDPTL    240
DPKYVNFLQS KCRWASEYVD LDATTPKTFD NVYYINLQKK MGLLSTDQLL YSDPRTSPLV    300
SALIASHSVF EHQFAVSMGK LGIVDVLTDQ DEGEIRTNCN FVNAY*                   360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00127530026+
cd00314plant_peroxidase_like8.0e-1388322262+
pfam00141peroxidase2.0e-3978210140+
PLN03030PLN030309.0e-6361343304+
cd00693secretory_peroxidase2.0e-13058342304+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU16698.1012381246unknown [Glycine max]
EMBLCAN60117.10583435308hypothetical protein [Vitis vinifera]
EMBLCBI27386.101834320341unnamed protein product [Vitis vinifera]
RefSeqXP_002265231.101834320355PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002304610.10623441291predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qo4_A0623447305A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB1pa2_A0623447305A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0583432294A Chain A, Peanut Peroxidase
PDB1sch_A0583432294A Chain A, Peanut Peroxidase
PDB3hdl_A0583442304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO041224266933460
EV282400255192610
GO037772260993460
CK6060042251343460
DW080352261462930
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00303.1
Arabidopsis lyrata473329
Arabidopsis thalianaAT1G30870.1
Brachypodium distachyonBradi1g26870.1
Brassica rapaBra014895Bra039872Bra023149
Capsella rubellaCarubv10010885m
Citrus clementinaCiclev10006591mCiclev10017746m
Citrus sinensisorange1.1g035963morange1.1g044134m
Cucumis sativusCucsa.118700.1Cucsa.134680.1
Eucalyptus grandisEucgr.F03670.1
Fragaria vescamrna19723.1-v1.0-hybridmrna19930.1-v1.0-hybrid
Glycine maxGlyma08g17300.1Glyma15g16710.1Glyma15g39210.2
Gossypium raimondiiGorai.011G069800.1
Linum usitatissimumLus10038393Lus10001228
Malus domesticaMDP0000171732MDP0000313080MDP0000190959MDP0000216403MDP0000906162
Manihot esculentacassava4.1_030325mcassava4.1_027488m
Medicago truncatulaMedtr4g133800.1
Mimulus guttatusmgv1a009857mmgv1a023785m
Oryza sativaLOC_Os07g31610.1
Panicum virgatumPavirv00017305mPavirv00018140m
Physcomitrella patensPp1s354_23V6.1
Phaseolus vulgarisPhvul.005G046000.1Phvul.009G244500.1
Picea abiesMA_44564g0010MA_10201061g0010MA_125874g0020
Populus trichocarpaPotri.010G175100.1Potri.003G156100.1
Prunus persicappa023679mppa017551m
Setaria italicaSi030295m
Sorghum bicolorSb02g033790.1
Thellungiella halophilaThhalv10008077m
Vitis viniferaGSVIVT01010080001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny