y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g08900.2
FamilyCE8
Protein PropertiesLength: 525 Molecular Weight: 57035.9 Isoelectric Point: 6.1972
ChromosomeChromosome/Scaffold: 09 Start: 8332309 End: 8336646
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82265070
  AIVAQDGSGNYKTVSEAIEAASGTTRFVIYVKEGVYKEKINTNKDGITLIGDGKYSTLIVGDDSVAKGAILPDSATFTITGDGFIARDIGFHNNAGPEGQ
  QAVALNIASDRSDTLYAHVLRQFYRECDIYGTIDFIFGNAAAVFQRCSLVLRRPHGHASYNAVLANGRTDPGQNTGFSVHKCTISPSSELSSVKGSYLSF
  LGRPWKEYSRAVVMESSIDDAVAASGWIEWPGYGGSVLRTLYFAEYGNEGAGAGTSKRVHWPGFRVLEAEEALKFTVAGFIG
Full Sequence
Protein Sequence     Length: 525     Download
MRTQELVVTF LVLGCALTWV SMSDGLVGGH QEHAHNECNL TRYPNLCAET LMELGLGNQN    60
VDNNIEALVN KTIFETSLPS SYFAEFKTGE AQPAHSVVAD YCEELMSMSL KRLDQSLRAL    120
KSPKRNTNDI QTWLSASLTF QQSCKDHVHA HTSTLSTDDH LMERMSNKMD YLSQLGSNSL    180
ALVNQMSTTT SHNIGDNNNE KEHEFPIWVS SKGRKLLQGA TIKANAIVAQ DGSGNYKTVS    240
EAIEAASGTT RFVIYVKEGV YKEKINTNKD GITLIGDGKY STLIVGDDSV AKGAILPDSA    300
TFTITGDGFI ARDIGFHNNA GPEGQQAVAL NIASDRSDTL YAHVLRQFYR ECDIYGTIDF    360
IFGNAAAVFQ RCSLVLRRPH GHASYNAVLA NGRTDPGQNT GFSVHKCTIS PSSELSSVKG    420
SYLSFLGRPW KEYSRAVVME SSIDDAVAAS GWIEWPGYGG SVLRTLYFAE YGNEGAGAGT    480
SKRVHWPGFR VLEAEEALKF TVAGFIGGNS WIPSTGVAFI SGLN*                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02170PLN021708.0e-12858523492+
PLN02484PLN024841.0e-12838524518+
PLN02301PLN023013.0e-144102523441+
pfam01095Pectinesterase2.0e-144225509301+
PLN02698PLN0269808523532+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK24761.10102523115555unknown [Picea sitchensis]
GenBankABK24883.103852369568unknown [Picea sitchensis]
RefSeqNP_197586.102950230489pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002277293.10295244480PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002516196.1085245527Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A02225231315B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A02185231319A Chain A, Pectin Methylesterase From Carrot
PDB1qjv_B6e-172255145340A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A6e-172255145340A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B9e-172255145340A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CX6360302702344920
EY6632392601994470
HO777316450935230
EE2553242482895250
CD5745562622735230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00025.1Aquca_020_00595.1
Arabidopsis lyrata326467
Arabidopsis thalianaAT5G20860.1
Brassica rapaBra020131
Carica papayaevm.model.supercontig_344.3
Capsella rubellaCarubv10003708m
Citrus clementinaCiclev10007964m
Citrus sinensisorange1.1g011489morange1.1g009545morange1.1g011611morange1.1g009418morange1.1g009682m
Eucalyptus grandisEucgr.C00760.1
Fragaria vescamrna12962.1-v1.0-hybrid
Gossypium raimondiiGorai.001G018200.1
Linum usitatissimumLus10017665Lus10033621Lus10025510
Malus domesticaMDP0000545023.761.939MDP0000545023.761.939
Manihot esculentacassava4.1_005313mcassava4.1_005427m
Mimulus guttatusmgv1a024664mmgv1a004362m
Phaseolus vulgarisPhvul.009G222700.1
Picea abiesMA_10435891g0010
Populus trichocarpaPotri.006G135100.1Potri.006G135100.2
Prunus persicappa016574m
Ricinus communis29739.m003679
Thellungiella halophilaThhalv10013149m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny