y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g21980.2
FamilyGH35
Protein PropertiesLength: 721 Molecular Weight: 81449.4 Isoelectric Point: 8.33
ChromosomeChromosome/Scaffold: 09 Start: 27130246 End: 27135124
Descriptionbeta-galactosidase 15
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35321359.99995e-41
  TIYGKRKVLFSSSIHYPRSSSKEGGLDVIETYVFWNAHEPQPRRYDFPGNLDLVKFIKTIEKEGLYAMLRIGPYVCAEWNYEGFRVWLHNMPNMEFRTNN
  TAYM
GH351422892.8026e-45
  EYGENGKQYVQWCAQLAESYKIGVPWVMCQQSDAPDPIINTCNGWYCDQFSPNSKIKPKMWTENWTGWFKNWGGPILHRTARDVAYVVARFLQYGGTFQN
  YYMYHRGTNFGRTSGGPYITTSYDYDAPLDEYVNKNQPKWGHLKLLHE
Full Sequence
Protein Sequence     Length: 721     Download
MTTQLALLLL SLTLVNFAIN TLEVSYDSRA ITIYGKRKVL FSSSIHYPRS SSKEGGLDVI    60
ETYVFWNAHE PQPRRYDFPG NLDLVKFIKT IEKEGLYAML RIGPYVCAEW NYEGFRVWLH    120
NMPNMEFRTN NTAYMYGNIM SEYGENGKQY VQWCAQLAES YKIGVPWVMC QQSDAPDPII    180
NTCNGWYCDQ FSPNSKIKPK MWTENWTGWF KNWGGPILHR TARDVAYVVA RFLQYGGTFQ    240
NYYMYHRGTN FGRTSGGPYI TTSYDYDAPL DEYVNKNQPK WGHLKLLHEL LKSMEDVLTQ    300
GTTNHTDYGN LLTLILCSLL LDLFACFIGN ANSSNDATIM FQSTQYIVPA WSVSILPSWV    360
NEVYNTAKIN AQTSIMVMKD SKSDNEEEPH STLNWQWMHE PHVQLKDGQV LGLVSRKAAQ    420
LLDQKVVTND TSDYLWYITS ESDCIWSKLR LSTNGHVLHV FVNGAQAGEL PYGQNGKYSF    480
TYEAKIKLKK GTNEISRLSG TDGLPNYGAH FSNVSVGVCG PVQLVTLQNN TEVVKDITNN    540
TWNYKVGLHG EIVKLYSPEN NNGWNTNGLP TNRVFVWYKT LFKSPKGTDP VVVDLRGLKK    600
GQAWVNGNNI GRYWTSYLAN ENGCTSTCNY RGPYSSDKCI TKCGRPTQRC FGVPEGECGS    660
FKKSQCESPN ALSILSKSCL GKQSCSVQVS QRMLGPTRCR VPQNQNKLAI EAVCESIAKK    720
*                                                                    780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1874LacA7.0e-1024128117+
PLN03059PLN030596.0e-1165171464+
pfam01301Glyco_hydro_352.0e-11330288317+
PLN03059PLN03059021654691+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI27773.101265528713unnamed protein product [Vitis vinifera]
EMBLCBI27773.10.0000000007651714773835unnamed protein product [Vitis vinifera]
RefSeqXP_002516237.1016551703beta-galactosidase, putative [Ricinus communis]
RefSeqXP_002516256.10165525725beta-galactosidase, putative [Ricinus communis]
RefSeqXP_002516256.10.000002651714785848beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A8e-30152871325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_B3e-293527514314A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB4e8d_A3e-293527514314A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Signal Peptide
Cleavage Site
18
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160690246550
HO780602623646380
HO7955525401045950
HO7955525521650
HO79555240651040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00261.4Aquca_034_00110.2
Brassica rapaBra013956.94.331Bra015236Bra003370Bra018721Bra013956.94.331
Carica papayaevm.model.supercontig_18.156
Citrus clementinaCiclev10007838mCiclev10004420mCiclev10000553m
Citrus sinensisorange1.1g007315morange1.1g006468morange1.1g004668morange1.1g005404m
Cucumis sativusCucsa.397380.5Cucsa.342700.4Cucsa.256570.2Cucsa.229010.2Cucsa.397380.6
Eucalyptus grandisEucgr.A01556.1.101.314Eucgr.A01556.1.101.314Eucgr.A01181.1
Fragaria vescamrna15210.1-v1.0-hybrid
Glycine maxGlyma15g35931.1Glyma09g21980.2.142.289Glyma09g21980.2.142.289Glyma14g07700.3
Gossypium raimondiiGorai.003G059500.4Gorai.011G065300.5Gorai.003G059500.3Gorai.003G059500.2Gorai.013G223000.1.124.295
Gorai.013G223000.1.124.295
Linum usitatissimumLus10023977.605.818
Manihot esculentacassava4.1_029736m
Medicago truncatulaMedtr1g018200.2AC235665_1070.1.117.327AC235665_1070.1.117.327
Mimulus guttatusmgv1a002308m
Oryza sativaLOC_Os03g15020.3
Panicum virgatumPavirv00064750m
Picea abiesMA_217488g0010MA_14774g0010
Populus trichocarpaPotri.007G018100.3Potri.006G144500.6Potri.001G200400.4Potri.001G200400.5
Prunus persicappa002177m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny