y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g26905.1
FamilyGH28
Protein PropertiesLength: 207 Molecular Weight: 23077 Isoelectric Point: 6.9295
ChromosomeChromosome/Scaffold: 09 Start: 33534161 End: 33535816
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH2841222e-35
  DGKTIAPTSSAAWGSSTLQWLNNITISGKGVIDGQGTVWWNNDSPTYNPTKALRFYGSDGVTITDITIQNSQQTHLKFDSCTNVQVSGISVSSPAPNTDG
  IHLQNSQNVVIYSSTLACG
Full Sequence
Protein Sequence     Length: 207     Download
MQWDGKTIAP TSSAAWGSST LQWLNNITIS GKGVIDGQGT VWWNNDSPTY NPTKALRFYG    60
SDGVTITDIT IQNSQQTHLK FDSCTNVQVS GISVSSPAPN TDGIHLQNSQ NVVIYSSTLA    120
CGLRLSDAPN VEKREMGLLS TLLKWIEVDP PSRDEKLRNE RICKFYQHNR NPFVDHPEYA    180
NLIWKQPIFL KTVSLIGWTG YEVLYV*                                        240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03010PLN030102.0e-151122130+
PLN02188PLN021883.0e-1623122107+
PLN02218PLN022186.0e-1924122109+
PLN02793PLN027935.0e-221122136+
pfam00295Glyco_hydro_284.0e-242122127+
Gene Ontology
GO TermDescription
GO:0004518nuclease activity
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD46483.101122106249polygalacturonase PG1 [Glycine max]
GenBankAAD46484.101122102245polygalacturonase PG2 [Glycine max]
GenBankACU24545.101122106249unknown [Glycine max]
DDBJBAH56488.16.02558e-441122161314polygalacturonase 1 [Prunus persica]
RefSeqNP_196969.17.00649e-441122111242polygalacturonase, putative / pectinase, putative [Arabidopsis thaliana]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FK01654012911070
GE34402912011115.60519e-45
BI784578106381245.04467e-44
BI784577106381245.04467e-44
CX65960014411221.99965e-42
Orthologous Group
SpeciesID
Brassica rapaBra014620
Glycine maxGlyma16g22488.1
Populus trichocarpaPotri.001G108000.1
Prunus persicappb019654m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny