y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g28610.2
FamilyCE10
Protein PropertiesLength: 186 Molecular Weight: 20593.8 Isoelectric Point: 7.7556
ChromosomeChromosome/Scaffold: 09 Start: 35531028 End: 35531885
Descriptioncarboxyesterase 18
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE10651386.3e-23
  FATSLNVVVVSVYYRLAPEHRYPSQYHDDLDVLKFLDQNDNVLSDVADVSKCFLAGDSMGANLTHHVAVRISKE
Full Sequence
Protein Sequence     Length: 186     Download
MAAEPTKAKL TLPWKVHLLT SLLSTLGGAS RRSNATINYR LFNLADRQSL PNPILIDGVS    60
SSAIFATSLN VVVVSVYYRL APEHRYPSQY HDDLDVLKFL DQNDNVLSDV ADVSKCFLAG    120
DSMGANLTHH VAVRISKEKL QMVNVIGLVS GKELQLIDYP NTFHGFYLFP ELPKEFMTKQ    180
MAIVN*                                                               240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10162PRK101629.0e-66614984+
COG0657Aes3.0e-1163182123+
pfam07859Abhydrolase_32.0e-236315088+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB89001.14e-311115018212CXE carboxylesterase [Malus pumila]
GenBankABB89001.10.003150174301325CXE carboxylesterase [Malus pumila]
RefSeqXP_002305855.13e-3311601230predicted protein [Populus trichocarpa]
RefSeqXP_002305855.10.0004150182298339predicted protein [Populus trichocarpa]
RefSeqXP_002518025.15e-27915014210Gibberellin receptor GID1, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2o7v_A0.0000000000000366156112216A Chain A, Crystal Structure Of A Methyltransferase-Like Protein (Spo2022) From Silicibacter Pomeroyi Dss-3 At 1.80 A Resolution
PDB2o7r_A0.0000000000000366156112216A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB3ed1_F0.000000000000672146147221A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB3ed1_E0.000000000000672146147221A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB3ed1_D0.000000000000672146147221A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA80130320011500
FS33439020411502e-38
FS33893720411504e-38
CD860445173301509e-38
EX66175119741506e-35
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00053.1Aquca_026_00256.1Aquca_026_00095.4Aquca_026_00095.1Aquca_026_00095.3
Aquca_026_00095.2Aquca_014_00051.1Aquca_009_00621.1Aquca_014_00054.1Aquca_001_00578.1
Aquca_001_00888.1Aquca_013_00490.1Aquca_013_00491.1Aquca_013_00492.1Aquca_026_00095.6
Aquca_026_00095.5Aquca_026_00095.7Aquca_001_00577.1
Arabidopsis lyrata496395488458351756904005486805
489214477795487467475988483697
Arabidopsis thalianaAT5G62180.1AT5G16080.1AT5G27320.1AT2G45600.1AT3G63010.1
AT5G23530.1AT3G05120.1AT5G06570.2AT5G06570.1AT1G68620.1
AT2G45610.1
Brachypodium distachyonBradi2g27300.1Bradi1g56860.1Bradi1g17780.1Bradi2g01817.1Bradi1g56830.1
Bradi1g19730.1Bradi1g06240.1Bradi1g19760.1Bradi1g19720.1Bradi1g67600.1
Bradi1g19715.1.49.348Bradi1g19715.1.49.348Bradi4g21690.1Bradi3g42207.1Bradi1g19750.1
Bradi4g21700.1Bradi1g21890.1Bradi2g25600.1Bradi1g19715.1.381.639Bradi1g19715.1.381.639
Bradi1g56807.1Bradi1g56870.1Bradi2g25470.1Bradi1g56910.1Bradi4g12370.1
Bradi5g08900.1Bradi3g21747.1Bradi1g56817.1Bradi1g67930.1
Brassica rapaBra035904Bra029278Bra040420Bra007722Bra008651
Bra009970Bra003520Bra004924Bra039460Bra009691
Bra026494Bra009207Bra004026Bra004327Bra004326
Bra038363Bra027693Bra004925Bra005899Bra029276
Carica papayaevm.model.supercontig_731.1evm.model.supercontig_142.11evm.model.supercontig_179.10evm.model.supercontig_142.10evm.model.supercontig_131.25
evm.model.supercontig_4.186evm.model.supercontig_18.158evm.model.supercontig_138.56evm.model.supercontig_3370.1evm.model.supercontig_18.159
evm.model.supercontig_259.4evm.model.supercontig_222.8evm.model.supercontig_84.118
Capsella rubellaCarubv10011599mCarubv10026772mCarubv10003763mCarubv10023611mCarubv10001368m
Carubv10017514mCarubv10025385mCarubv10014098mCarubv10001401mCarubv10020617m
Carubv10000013m
Citrus clementinaCiclev10005338mCiclev10026049mCiclev10012053mCiclev10020968mCiclev10028832m
Ciclev10001720mCiclev10024217mCiclev10005441mCiclev10020805mCiclev10005443m
Ciclev10031957mCiclev10020972mCiclev10024259mCiclev10007129mCiclev10001722m
Ciclev10020963mCiclev10007184mCiclev10005496mCiclev10021081mCiclev10024355m
Ciclev10002159mCiclev10012167mCiclev10005552mCiclev10023897mCiclev10012177m
Ciclev10003873mCiclev10001815mCiclev10020996mCiclev10012538mCiclev10007157m
Citrus sinensisorange1.1g019246morange1.1g020406morange1.1g019624morange1.1g019201morange1.1g019193m
orange1.1g038316morange1.1g039669morange1.1g019097morange1.1g019164morange1.1g019248m
orange1.1g019235morange1.1g038541morange1.1g024327morange1.1g024286morange1.1g020140m
orange1.1g042852morange1.1g041117morange1.1g040187morange1.1g020268morange1.1g019460m
orange1.1g040311morange1.1g026700morange1.1g038786morange1.1g029457morange1.1g039748m
orange1.1g036408morange1.1g036204morange1.1g042985m
Cucumis sativusCucsa.212660.1Cucsa.237740.1Cucsa.083880.1Cucsa.005130.1Cucsa.388430.1
Cucsa.153090.1Cucsa.055880.1Cucsa.088490.1Cucsa.163740.1Cucsa.237690.1
Cucsa.084780.1Cucsa.237670.1Cucsa.283760.1Cucsa.362930.1Cucsa.273140.1
Cucsa.237730.1
Eucalyptus grandisEucgr.A02852.1Eucgr.K03422.1Eucgr.A02850.1Eucgr.A02538.1Eucgr.A02854.1
Eucgr.B02030.2Eucgr.B02030.1Eucgr.A02853.1Eucgr.A02855.1Eucgr.J01495.1
Eucgr.B02030.3Eucgr.B03798.1Eucgr.J01051.1Eucgr.H01611.1Eucgr.I00033.1
Eucgr.J01049.1Eucgr.B03032.1Eucgr.J01050.1Eucgr.J01047.1Eucgr.C01748.1
Eucgr.A02537.1Eucgr.G03202.1Eucgr.H02260.1Eucgr.J01052.1Eucgr.D02432.1
Fragaria vescamrna10312.1-v1.0-hybridmrna21464.1-v1.0-hybridmrna21852.1-v1.0-hybridmrna31238.1-v1.0-hybridmrna22353.1-v1.0-hybrid
mrna18038.1-v1.0-hybridmrna03774.1-v1.0-hybridmrna13362.1-v1.0-hybridmrna21461.1-v1.0-hybridmrna13361.1-v1.0-hybrid
mrna19449.1-v1.0-hybridmrna20092.1-v1.0-hybridmrna27756.1-v1.0-hybridmrna14708.1-v1.0-hybridmrna11640.1-v1.0-hybrid
mrna19448.1-v1.0-hybridmrna21445.1-v1.0-hybridmrna14710.1-v1.0-hybridmrna21850.1-v1.0-hybrid
Glycine maxGlyma20g29190.1Glyma06g46520.1Glyma10g29910.1Glyma09g27516.1Glyma20g37430.3
Glyma20g37430.2Glyma02g17010.1Glyma16g33340.1Glyma08g47930.1Glyma19g39030.1
Glyma20g29200.1Glyma02g27091.1Glyma18g53580.1Glyma10g02790.1Glyma16g33330.1
Glyma03g36380.1Glyma03g30460.1Glyma06g46680.1Glyma09g28580.1Glyma10g11060.1
Glyma16g33320.1Glyma17g31740.1Glyma09g28590.1Glyma12g10250.2Glyma10g42260.1
Glyma20g24780.1Glyma07g09030.1Glyma03g02330.1Glyma06g46520.2Glyma16g32560.1
Glyma07g09040.1Glyma16g32571.1Glyma03g36380.2Glyma04g15930.2Glyma13g25900.2
Gossypium raimondiiGorai.008G054000.1Gorai.013G203500.1Gorai.013G203500.2Gorai.006G117200.2Gorai.004G265600.1
Gorai.006G117200.1Gorai.008G007200.1Gorai.007G301300.1Gorai.004G244100.1Gorai.N020400.2
Gorai.N020400.1Gorai.N020400.4Gorai.N020400.3Gorai.007G180400.1Gorai.004G265700.1
Gorai.010G114500.1Gorai.010G215600.1Gorai.001G173200.1Gorai.004G214300.1Gorai.007G132800.2
Gorai.007G132800.1Gorai.011G116900.1Gorai.008G282100.1Gorai.012G038300.1Gorai.008G184600.1
Gorai.003G140500.2Gorai.003G140500.1Gorai.006G146700.1Gorai.007G301300.2Gorai.007G093200.1
Linum usitatissimumLus10013774Lus10002254Lus10000928Lus10017587Lus10024087
Lus10013377Lus10002019Lus10033548Lus10039162Lus10041632
Lus10009308Lus10008439Lus10002907Lus10015988Lus10027969
Lus10015989Lus10036168Lus10029541Lus10041473Lus10016204
Lus10029341Lus10013376Lus10018963
Malus domesticaMDP0000266393MDP0000549369MDP0000702676MDP0000302390MDP0000209102
MDP0000445131MDP0000868088MDP0000193399MDP0000933387MDP0000823593
MDP0000834172MDP0000153512MDP0000638650MDP0000729982MDP0000293827
MDP0000319301MDP0000929994MDP0000212363MDP0000319522MDP0000394001
MDP0000772938MDP0000376469MDP0000811098MDP0000767905MDP0000830926
MDP0000188790MDP0000769340MDP0000682570MDP0000131356MDP0000121191
MDP0000312660MDP0000501425MDP0000206715MDP0000173942
Manihot esculentacassava4.1_021781mcassava4.1_022890mcassava4.1_027884mcassava4.1_011475mcassava4.1_024162m
cassava4.1_023579mcassava4.1_011926mcassava4.1_021060mcassava4.1_011042mcassava4.1_011040m
cassava4.1_011041mcassava4.1_011074mcassava4.1_011423mcassava4.1_011066mcassava4.1_030617m
cassava4.1_010495mcassava4.1_011600mcassava4.1_011817mcassava4.1_032011mcassava4.1_028611m
cassava4.1_024667mcassava4.1_011349mcassava4.1_011547mcassava4.1_020892mcassava4.1_021805m
cassava4.1_029404mcassava4.1_027577m
Medicago truncatulaMedtr1g102170.1Medtr1g082210.1Medtr1g089310.1Medtr6g065430.1Medtr6g065120.1
Medtr7g093950.1Medtr6g065270.1Medtr8g035540.1Medtr6g065400.1Medtr1g102160.1
Medtr8g035520.1Medtr6g065370.1Medtr6g065110.1Medtr6g065340.1AC233660_26.1
Medtr8g035500.1Medtr1g012430.1
Mimulus guttatusmgv1a010087mmgv1a009262mmgv1a009369mmgv1a018241mmgv1a009399m
mgv1a009336mmgv1a008950mmgv1a018055mmgv1a023984mmgv1a008534m
mgv1a008668mmgv1a018147mmgv1a008861mmgv1a008737mmgv1a010399m
mgv1a008690mmgv1a009655mmgv1a023895mmgv1a010082mmgv1a010080m
mgv1a019510mmgv11b023492mmgv11b021044m
Oryza sativaLOC_Os01g06220.1LOC_Os07g44890.1LOC_Os01g06060.1LOC_Os01g06210.1LOC_Os03g57640.1
LOC_Os07g44860.1LOC_Os07g06850.1LOC_Os07g06880.1LOC_Os07g06860.1LOC_Os08g43430.1
LOC_Os11g13570.1LOC_Os06g20200.1LOC_Os11g13670.1LOC_Os07g06840.1LOC_Os07g44900.1
LOC_Os07g44910.2LOC_Os07g44910.1LOC_Os07g44850.1LOC_Os07g41590.1LOC_Os11g13630.1
LOC_Os05g33730.1LOC_Os03g15270.1LOC_Os07g06830.1LOC_Os03g14730.1LOC_Os05g33940.1
LOC_Os12g04150.1LOC_Os11g04350.1LOC_Os12g04140.1LOC_Os11g04360.1
Panicum virgatumPavirv00008025mPavirv00015838mPavirv00058244mPavirv00014880mPavirv00041749m
Pavirv00056548mPavirv00023156mPavirv00070174mPavirv00048179mPavirv00052142m
Pavirv00001191mPavirv00030872mPavirv00006154mPavirv00058907mPavirv00041750m
Pavirv00026130mPavirv00008276mPavirv00055122mPavirv00021506mPavirv00024792m
Pavirv00028910mPavirv00055985mPavirv00055986mPavirv00063807mPavirv00057275m
Pavirv00025759mPavirv00058002mPavirv00018247mPavirv00033006mPavirv00028147m
Pavirv00002247mPavirv00024029mPavirv00036540mPavirv00025899mPavirv00058927m
Pavirv00012215mPavirv00069461mPavirv00022808mPavirv00042463mPavirv00061274m
Pavirv00034983mPavirv00066260mPavirv00048346mPavirv00033502mPavirv00068878m
Pavirv00016447mPavirv00068880mPavirv00034848mPavirv00011581mPavirv00033501m
Pavirv00019866mPavirv00027406mPavirv00032027mPavirv00022807mPavirv00028051m
Pavirv00017465mPavirv00042989mPavirv00042520mPavirv00034561m
Physcomitrella patensPp1s297_21V6.4Pp1s297_21V6.3Pp1s297_21V6.2Pp1s297_21V6.1Pp1s25_331V6.1
Pp1s37_32V6.4Pp1s37_32V6.3Pp1s37_32V6.2Pp1s37_32V6.1Pp1s91_36V6.1
Pp1s33_210V6.1
Phaseolus vulgarisPhvul.011G100900.1Phvul.004G123800.1Phvul.011G100800.1Phvul.007G064600.1Phvul.007G183400.1
Phvul.007G167600.1Phvul.007G064700.1Phvul.004G132800.1Phvul.004G133000.1Phvul.005G016400.1
Phvul.001G146300.1Phvul.001G198900.1Phvul.004G073600.1Phvul.004G133100.1Phvul.004G074300.1
Phvul.007G264900.1Phvul.010G086500.1Phvul.004G123900.1Phvul.008G004600.1Phvul.011G197000.1
Phvul.007G025700.1Phvul.010G086400.1Phvul.001G051600.1Phvul.004G123700.1Phvul.004G074400.1
Picea abiesMA_9721034g0010MA_10296151g0010MA_9392760g0010MA_10435233g0020MA_46821g0010
MA_42231g0010MA_304461g0010MA_5588g0010MA_101170g0020MA_3180g0010
MA_129063g0010MA_10207543g0010MA_170302g0010MA_16525g0010MA_28455g0010
MA_8180539g0010MA_93044g0010MA_269822g0010MA_423315g0010MA_10437184g0010.195.444
MA_10437184g0010.195.444MA_55939g0010MA_10429622g0010.151.347MA_10429622g0010.151.347MA_131537g0010
MA_6062370g0010MA_10432405g0010MA_10382897g0010MA_7579711g0010MA_27832g0010
MA_10426025g0010MA_10426093g0030MA_9955818g0010MA_10428213g0010MA_23660g0010
MA_17969g0010MA_8981253g0010MA_81388g0010MA_10428792g0010MA_10437184g0010.59.189
MA_10437184g0010.59.189MA_10429622g0010.18.122MA_10429622g0010.18.122MA_96486g0010MA_4826396g0010
Populus trichocarpaPotri.001G032400.1Potri.003G192600.1Potri.017G113700.1Potri.015G137100.1Potri.T024600.1
Potri.019G014400.1Potri.005G040600.1Potri.004G101400.1Potri.009G155800.1Potri.013G028700.1
Potri.014G135900.3Potri.014G135900.2Potri.014G135900.1Potri.002G213100.1Potri.006G198800.1
Potri.014G073000.1Potri.001G459400.1Potri.004G092500.1Potri.016G065000.1Potri.001G466200.1
Potri.001G466400.1Potri.010G127600.1Potri.001G466300.1Potri.T024800.1Potri.018G028300.1
Potri.008G118400.1Potri.016G031500.1Potri.002G150900.1Potri.006G253300.1Potri.016G065000.2
Potri.018G028400.1Potri.014G073100.1Potri.004G075000.1
Prunus persicappa008273mppa018617mppa016280mppa023695mppa008373m
ppa008440mppa026008mppa018174mppa008578mppa023957m
ppa019404mppa008128mppa008109mppa008412mppa009018m
ppa026623mppa016730mppa023588mppa021562m
Ricinus communis30147.m01414130205.m00158529686.m00086129910.m00096629910.m000927
30128.m00869530008.m00079629703.m00150629333.m00109830147.m014142
28883.m00073629755.m00044029983.m00330430174.m00892130174.m008923
30174.m00892229848.m004636
Setaria italicaSi030325mSi030352mSi026570mSi030400mSi002225m
Si032545mSi036588mSi036247mSi030423mSi030411m
Si030476mSi030409mSi039159mSi030397mSi022545m
Si026572mSi029953mSi032705mSi030425mSi022513m
Si022510mSi014005mSi014968mSi030493mSi024051m
Si032595mSi025071mSi027458mSi026510mSi036079m
Si003165m
Selaginella moellendorffii1012418983489683166817169817
1698131473012632825100138855
97885146043511427114314639
1038212453934699440349
Sorghum bicolorSb05g007290.1Sb02g003610.1Sb02g003620.1Sb01g005720.1Sb03g005590.1
Sb02g003580.1Sb02g003600.1Sb02g020810.1Sb02g003570.1Sb02g041040.1
Sb05g007270.1Sb07g025010.1Sb03g005570.1Sb02g041050.1Sb02g038880.1
Sb09g020080.1Sb09g020080.2Sb02g041000.1Sb02g003630.1Sb01g040580.1
Sb02g003560.1Sb03g005580.1Sb03g005560.1Sb09g020220.1Sb09g020230.1
Sb05g008440.1Sb01g040930.1Sb02g041020.1Sb05g008610.1
Thellungiella halophilaThhalv10005595mThhalv10013981mThhalv10004511mThhalv10006072mThhalv10004556m
Thhalv10021054mThhalv10014072mThhalv10019529mThhalv10001767mThhalv10001557m
Vitis viniferaGSVIVT01010672001GSVIVT01037525001GSVIVT01022014001GSVIVT01018455001GSVIVT01025780001
GSVIVT01022491001GSVIVT01035846001.199.457GSVIVT01035846001.199.457GSVIVT01035846001.199.457GSVIVT01035846001.199.457
GSVIVT01035848001GSVIVT01022508001GSVIVT01035846001.602.875GSVIVT01035846001.602.875GSVIVT01035846001.602.875
GSVIVT01035846001.602.875GSVIVT01035849001GSVIVT01031065001GSVIVT01036591001GSVIVT01011037001
GSVIVT01011925001GSVIVT01022510001GSVIVT01025797001GSVIVT01037191001GSVIVT01037190001
GSVIVT01000258001GSVIVT01027566001GSVIVT01027568001
Zea maysAC211504.4_FGT003AC209636.2_FGT003
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)