y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g29160.1
FamilyGT1
Protein PropertiesLength: 481 Molecular Weight: 52515.3 Isoelectric Point: 5.2437
ChromosomeChromosome/Scaffold: 09 Start: 36099655 End: 36101761
DescriptionUDP-glucosyl transferase 71B6
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12734601.5e-30
  VKWLDEQSKGSVVYVSLGNRTETRREQIKDMALGLIECGYGFLWVVKLKRVDKEDEEGLEEVLGSELSSKVKEKGVVVKEFVDQVEILGHPSVGGFLSHG
  GWNSVTETVWKGVPCLSWPQHSDQKMSAEVIRMSGMGIWPEEWGWGTQDVVKGDEIAKRIKEMMSNESLRVKAGELKEAALKAAGVGG
Full Sequence
Protein Sequence     Length: 481     Download
MSSSEGVVHV AFLPSAGMGH LNPFLRLAAT FIRYGCKVTL ITPKPTVSLA ESNLISRFCS    60
SFPHQVTQLD LNLVSVDPTT VDTIDPFFLQ FETIRRSLHL LPPILSLLST PLSAFIYDIT    120
LITPLLSVIE KLSCPSYLYF TSSARMFSFF ARVSVLSASN PGQTPSSFIG DDGVKIPGFT    180
SPIPRSSVPP AILQASSNLF QRIMLEDSAN VTKLNNGVFI NSFEELEGEA LAALNGGKVL    240
EGLPPVYGVG PLMACEYEKG DEEGQKGCMS SIVKWLDEQS KGSVVYVSLG NRTETRREQI    300
KDMALGLIEC GYGFLWVVKL KRVDKEDEEG LEEVLGSELS SKVKEKGVVV KEFVDQVEIL    360
GHPSVGGFLS HGGWNSVTET VWKGVPCLSW PQHSDQKMSA EVIRMSGMGI WPEEWGWGTQ    420
DVVKGDEIAK RIKEMMSNES LRVKAGELKE AALKAAGVGG SCEVTIKRQI EEWKRNAQAN    480
*                                                                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02167PLN021678.0e-32124439324+
PLN02207PLN022077.0e-328400411+
PLN02554PLN025543.0e-3312476494+
PLN02448PLN024481.0e-33114440345+
PLN00164PLN001646.0e-3710410430+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU22927.1013461346unknown [Glycine max]
GenBankEAZ00578.10946621466hypothetical protein OsI_22597 [Oryza sativa Indica Group]
RefSeqNP_001147999.10947722482anthocyanidin 3-O-glucosyltransferase [Zea mays]
RefSeqXP_002306046.1024754460predicted protein [Populus trichocarpa]
RefSeqXP_002532899.1034755461UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2acv_B1.4013e-4514723460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A1.4013e-4514723460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acw_B1.4013e-4514723460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2acw_A1.4013e-4514723460A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
PDB2vg8_A5.00264e-4394788472A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose
Metabolic Pathways
Pathway NameReactionECProtein Name
rose anthocyanin biosynthesisRXN-8005EC-2.4.1UDP-D-glucose:cyanidin 5-O-β-D-glucosyltransferase
rose anthocyanin biosynthesisRXN-8006EC-2.4.1cyanidin 5,3-O-glycosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV28134225912590
FK02019221812180
FK01887520212020
EH25911718711870
BI7014131701142830
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00760.1Aquca_002_00759.1
Brachypodium distachyonBradi1g44630.1Bradi1g43410.1
Citrus clementinaCiclev10013670mCiclev10031419m
Citrus sinensisorange1.1g043530morange1.1g012061m
Cucumis sativusCucsa.284670.1
Eucalyptus grandisEucgr.E03235.1Eucgr.E03236.1Eucgr.D01288.1Eucgr.E03234.1Eucgr.E03232.1
Eucgr.E03231.1Eucgr.J01468.1Eucgr.E03233.1
Fragaria vescamrna04355.1-v1.0-hybridmrna04357.1-v1.0-hybridmrna04359.1-v1.0-hybrid
Glycine maxGlyma16g33750.1
Gossypium raimondiiGorai.012G050700.1Gorai.013G091400.3Gorai.013G091400.2Gorai.013G091400.4
Linum usitatissimumLus10036967Lus10036969Lus10037114
Malus domesticaMDP0000286574MDP0000120215MDP0000253523MDP0000544455MDP0000548511
Manihot esculentacassava4.1_007235mcassava4.1_007252mcassava4.1_022558m
Medicago truncatulaMedtr4g082810.1Medtr6g078320.1Medtr4g082820.1
Mimulus guttatusmgv1a022922mmgv1a006046mmgv1a020049m
Oryza sativaLOC_Os06g18670.1LOC_Os06g18010.1LOC_Os06g18140.1LOC_Os06g18790.1
Panicum virgatumPavirv00001007mPavirv00009357mPavirv00054865m
Phaseolus vulgarisPhvul.004G138400.1Phvul.004G138200.1Phvul.004G137900.1Phvul.004G137900.2
Populus trichocarpaPotri.017G089000.1Potri.004G126000.1
Prunus persicappa005427mppa027121mppa015845mppa023609m
Ricinus communis28124.m000238
Setaria italicaSi007944mSi006299mSi006342m
Sorghum bicolorSb10g001230.1Sb07g002370.1Sb10g010640.1Sb10g010590.1Sb10g010610.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny