y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g29470.1
FamilyGT66
Protein PropertiesLength: 730 Molecular Weight: 81963.5 Isoelectric Point: 9.3712
ChromosomeChromosome/Scaffold: 09 Start: 36348755 End: 36355214
Descriptionstaurosporin and temperature sensitive 3-like b
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66346790
  LIRVATLSLIYVLAFITRLFSVLRYESMIHEFDPYFNYRTTLFLTRNGFAEFWNWFDSESWYPLGRIIGGTLYPGLMLTAAAIHSLLRFLRLFVHIREVC
  VLTAPFFASNTTLVAYFFAKEVWDSGAGIVAAALIAICPGYISRSVAGSYDNEGVAIFALLLTFYLFVKAVNTGSLAWALGSAFGYFYMVSAWGGYVFII
  NLVPLYVLVLLVTGRYSMRLYVAYNCMYVLGMLLAMQIRFVGFQHVQSGEHMAAMGVFFLLQVFFFLDWVRHLLSDTKLFQAFLRITVTSAVAVGAVALG
  VGTASGYISPWTGRFYSLLDPTYAKDHIPIIASVSEHQPTAWSSFMFDFHILLFLFPAGLYFCFKRLSDATIFLVMYGLTSMYFAGVMVRLILVATPAVC
  LISAIAVSATVKNLTRVVRAKSQAVQSGSTKGTSSAKSSAKGVVDNSQPFQKNGAIVLLLGAFYLLSRYAIHCTWVTSEAYSSPSIVLAARGAHGNRVIF
  DDYREAYFWLRQNTPQDAKVMSWWDYGYQITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYDIMRSLDVDYVLVVFGGVTGYSSDDINKFLWMVRI
  GGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELT
Full Sequence
Protein Sequence     Length: 730     Download
MVVTSKPSPM ALDLKTSFTL PKTLKLKTKQ QELLIRVATL SLIYVLAFIT RLFSVLRYES    60
MIHEFDPYFN YRTTLFLTRN GFAEFWNWFD SESWYPLGRI IGGTLYPGLM LTAAAIHSLL    120
RFLRLFVHIR EVCVLTAPFF ASNTTLVAYF FAKEVWDSGA GIVAAALIAI CPGYISRSVA    180
GSYDNEGVAI FALLLTFYLF VKAVNTGSLA WALGSAFGYF YMVSAWGGYV FIINLVPLYV    240
LVLLVTGRYS MRLYVAYNCM YVLGMLLAMQ IRFVGFQHVQ SGEHMAAMGV FFLLQVFFFL    300
DWVRHLLSDT KLFQAFLRIT VTSAVAVGAV ALGVGTASGY ISPWTGRFYS LLDPTYAKDH    360
IPIIASVSEH QPTAWSSFMF DFHILLFLFP AGLYFCFKRL SDATIFLVMY GLTSMYFAGV    420
MVRLILVATP AVCLISAIAV SATVKNLTRV VRAKSQAVQS GSTKGTSSAK SSAKGVVDNS    480
QPFQKNGAIV LLLGAFYLLS RYAIHCTWVT SEAYSSPSIV LAARGAHGNR VIFDDYREAY    540
FWLRQNTPQD AKVMSWWDYG YQITAMGNRT VIVDNNTWNN THIATVGRAM SSYEDEAYDI    600
MRSLDVDYVL VVFGGVTGYS SDDINKFLWM VRIGGGVFPV IKEPDYLVNG EYRVDKGAAP    660
KMLNCLMYKL SYYRFGELTT EYGKPPGYDR ARGVEIGNKD IKLEYLEEAF TTQNWIVRIY    720
KVKPPKNRW*                                                           780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT32.0e-6362611284+
TIGR04154archaeo_STT38.0e-1140233218+
COG1287COG12877.0e-5732727733+
pfam02516STT32.0e-12934680663+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBG76274.102272816706OO_Ba0005L10-OO_Ba0081K17.25 [Oryza officinalis]
RefSeqNP_174675.201472820734STT3B (staurosporin and temperature sensitive 3-like b); oligosaccharyl transferase [Arabidopsis thaliana]
RefSeqXP_002269119.1037297737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318345.103072922721predicted protein [Populus trichocarpa]
RefSeqXP_002329687.101372923721predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A050572320238A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.000085356516123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.000085356516123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.000085356516123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vgp_A0.00065346356113A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
3355
98120
127149
159181
188210
225247
254276
286308
315337
375397
404426
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8701293234067280
GT0360633473046500
GT0332323193466640
GO8695183263797040
GO869518196957131
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma16g33881.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)