y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma09g33340.2
FamilyCBM57
Protein PropertiesLength: 1068 Molecular Weight: 120212 Isoelectric Point: 7.0707
ChromosomeChromosome/Scaffold: 09 Start: 39824377 End: 39830883
DescriptionDi-glucose binding protein with Kinesin motor domain
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM57612041.4e-33
  MFVNAGGDAFSEEAGGITFLADTYFDGGNVMRTNEQIVEGGDYPFIYQSARLGSFCYRFDNLPPGDYIVDLHFVEIININGPKGMRVFNVHIQDEKVLSE
  LDIYAVVGANKPLQMVDLRVSVKDDGVILIRFESISGSPVVSGI
Full Sequence
Protein Sequence     Length: 1068     Download
MDPTQSNDVL QYPQTLISEP KDSPMQDANE SLFDSMVCDS SSRLIPTGFT RSDNAEEDCF    60
MFVNAGGDAF SEEAGGITFL ADTYFDGGNV MRTNEQIVEG GDYPFIYQSA RLGSFCYRFD    120
NLPPGDYIVD LHFVEIININ GPKGMRVFNV HIQDEKVLSE LDIYAVVGAN KPLQMVDLRV    180
SVKDDGVILI RFESISGSPV VSGICIRRAT KAPVPQVKSD YIKCSSCAVQ IEIPSSQMKV    240
MQAKSTAKYE SKIKELTMQC DLKAKECYQA WMSLTATNEQ LEEVQMELDK VTFNSLTTDQ    300
TVEKQAESLR NISNRYELDK KKWAEAINSL QEKIKLMKSD YSNLSFEAHE CVDSIPELNK    360
MVFAVQDLVK QCEDLKVKYN EEMAKRKKLF NEVQEAKGNI RVFCRCRPLN KAEISAGCNT    420
IVDFDAAKDS CLGILTSGST KKSFRFDRVY TPKDDQVDVF ADASSMVISV LDGYNVCIFA    480
YGQTGTGKTF TMEGTQQNRG VNYRTLEHLF KVSKERSETF SYDISVSVIE VYNEQIRDLL    540
ATGQTSKRLE IKQASEGFHH VPGVVEARID NINEVWNVLQ VGNNARAVGS NNVNEHSSRS    600
HCLLCIAVKA KNLLNGESTK SKLWLVDLAG SERLAKTDVQ GERLKEAQNI NRSLSALGDV    660
ISALAAKSSH IPYRNSKLTH LLQDSLGGDS KTLMFVQISP SDQDVGETLS SLNFATRVRG    720
VELGPVKKQI DTSEVQKMKA MLEKARSECR IKDESMRKLE ENLQNLESKA KGKDQIYKNL    780
QEKIKELEGQ IELKKAMQND SEKQISQLSD KLRGKEETCS TLQQKVKELE KKMKEQLQSE    840
SASFQQKVWD LEKKLKDQMQ GSESESAILK DKIKELERKL KEQEQSSMSL LRQQMEQLED    900
RYREREQQWQ QTDSFVDATV KAATPDVGKS CMSEECPSEI ETGILRCSDS ENRQISQGSS    960
LFKGNGSTRK ISQGSCLFKG NDSTHKIRSK REFRSNDENN FAMPSSLQHD RRVARKSDPP    1020
KIVRGLRPTP RPVTANLAPV SHKRASTSRD QVQGIKERDT KKKIWSR*                 1080
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd01369KISc_KHC_KIF54.0e-104399717324+
cd00106KISc9.0e-122399719329+
smart00129KISc2.0e-133399727336+
pfam00225Kinesin3.0e-138405721326+
cd01366KISc_C_terminal1.0e-176397724330+
Gene Ontology
GO TermDescription
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0007018microtubule-based movement
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN63715.101105111063hypothetical protein [Vitis vinifera]
EMBLCBI40845.107710671979unnamed protein product [Vitis vinifera]
RefSeqXP_002266404.1018231847PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002266404.11e-218241067759982PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002532381.101984037857ATP binding protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2h58_A03967232330A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp
PDB3h4s_A03867751383A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_C03947421347A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cob_A03947421347A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
PDB3cnz_B03947421347A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FL9216582584897460
EL4429302664857480
DV9908453024537500
EH1942273375328680
ES8650562874667480
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_015_00213.1Aquca_015_00213.2
Arabidopsis thalianaAT2G22610.1AT2G22610.2
Brassica rapaBra038507Bra016076
Carica papayaevm.model.supercontig_229.5evm.model.supercontig_21.41
Capsella rubellaCarubv10022542mCarubv10022541m
Citrus clementinaCiclev10000147mCiclev10024772m
Citrus sinensisorange1.1g037169morange1.1g001679m
Fragaria vescamrna20704.1-v1.0-hybridmrna26561.1-v1.0-hybrid
Glycine maxGlyma01g02620.1
Gossypium raimondiiGorai.008G093800.1Gorai.009G228400.1Gorai.002G032500.3Gorai.002G032500.2Gorai.002G032500.1
Linum usitatissimumLus10005582Lus10035954Lus10025708Lus10013714
Malus domesticaMDP0000317970
Manihot esculentacassava4.1_032042mcassava4.1_000724m
Medicago truncatulaAC174330_12.1AC146711_18.1AC146711_37.1Medtr5g031470.1
Mimulus guttatusmgv1a000533m
Physcomitrella patensPp1s9_137V6.1Pp1s403_54V6.1
Phaseolus vulgarisPhvul.002G145000.1
Picea abiesMA_180169g0010
Populus trichocarpaPotri.002G110600.2Potri.011G140000.1Potri.001G436200.1Potri.001G436200.2Potri.001G436200.4
Potri.002G110600.1
Prunus persicappa014706mppa015110m
Ricinus communis29591.m00013929235.m00023229596.m000713
Selaginella moellendorffii13900998850
Vitis viniferaGSVIVT01003948001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny