y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g00350.1
FamilyCE10
Protein PropertiesLength: 827 Molecular Weight: 89581.7 Isoelectric Point: 7.0695
ChromosomeChromosome/Scaffold: 10 Start: 126916 End: 136891
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105878101.6e-29
  KSDALDPLIVVLHGGPHTVSLSSFSKPLAYLSSLGYSLLIVNYRGSLGFGEEALQSLPGKAGSQDVNDVLTAIDHVINLGLASPSKIAVLGGSHGGFLTT
  HLIGQAPEKFVAAAARNPVCNLALMVGTTDIPDWCYVETYGTKGRDKFTEAPSAEDLTLFYSKSPIAHLSKVKTPTIFLLGAQDLRVPISTGLQYARALR
  EKGGQVKVIVFPNDVHGIERPQSD
Full Sequence
Protein Sequence     Length: 827     Download
MACSRVANWC VAVAVSPSTL FPRISPTLNP NPNYLSSSVA PTPLSLSLTG RRFSSSPVSA    60
MDKEDAAAAE QEYALHSTLL QEFTAISAID KAWLFKSHTH TASASSSHAM FCVSQPNLLV    120
NKRKKSIVSA TILTQNDASS VTFQWAPFPI QVSGVSAMVP SPSGSKLLIV RNPESDGPCR    180
FEIWSSSQLQ KEFHIPPSKH GSVYTDGWFE GISWNSDETC IAYVAEEPAP TKPTFNDLGG    240
YKKAGSSEKD CGTWKGQGEW EEDWGETYAG KRQPAPFVIN INSGEVQAVK GIDKSLSVGQ    300
VVWAPSTEGS AQHLVFVGWT FETRKLGIKY CYNRPCALYV VKAPHHESKA NETEIHSTED    360
VQAVNLTQTI SSAFFPRFSP DGKFLVFVSA RSSVDSGVHS ATDSLHRIDW PEDSKLYKSA    420
KIHEVIPVVL FAEDGGFPGL YCSTILSDPW LSDGYTLVIA SIWHSSQVLL SINVLSGELL    480
RITPADSNFS WSLLALDGNN ILAVSSSPVD VPQIKYGAIV KKAANNKEWS WSDVANPIFK    540
CSDKVRSLIS SLTFSIMKIS VKDISASLTK GASQPYEAIF VSSKTKKSDA LDPLIVVLHG    600
GPHTVSLSSF SKPLAYLSSL GYSLLIVNYR GSLGFGEEAL QSLPGKAGSQ DVNDVLTAID    660
HVINLGLASP SKIAVLGGSH GGFLTTHLIG QAPEKFVAAA ARNPVCNLAL MVGTTDIPDW    720
CYVETYGTKG RDKFTEAPSA EDLTLFYSKS PIAHLSKVKT PTIFLLGAQD LRVPISTGLQ    780
YARALREKGG QVKVIVFPND VHGIERPQSD FESYLNIAMW FNKYCK*                  840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG1505COG15059.0e-8571792227+
pfam12697Abhydrolase_68.0e-9595808216+
pfam00326Peptidase_S92.0e-31626824202+
COG1506DAP22.0e-37363826476+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26348.103882638822unnamed protein product [Vitis vinifera]
RefSeqNP_193193.207082621763acylaminoacyl-peptidase-related [Arabidopsis thaliana]
RefSeqXP_002284013.106882619770PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002284016.106882619760PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002517031.106782618771acylamino-acid-releasing enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B2e-18593803379579A Chain A, Vegfr-2VEGF-A Complex Structure
PDB4hxe_B2e-18593803379579B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L4e-18593803379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K4e-18593803379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J4e-18593803379579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7820172595698270
FF5458422654937570
HO7975573095368270
GO8504863444808230
GO8504843394808180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)