y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma10g01355.1
FamilyCE8
Protein PropertiesLength: 268 Molecular Weight: 29808.9 Isoelectric Point: 9.6899
ChromosomeChromosome/Scaffold: 10 Start: 994937 End: 998265
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8601381.1e-23
  VSQDGTGDFKTITEALNSIPPRNTRRVIVSIAPGVYREKVMIPKTLPFITLLGDAGDPPTITGNDTASVSGRTFQSATV
CE81362601.5e-39
  ATVQNCYLNSTTRKVASITAQKRTNSSLESGFSFKNCTVIGSGQVYLGRAWGDYSRVVFSYTFMDNIVLAKGWSDWGDQKRDSRVYYGEYKCSGPGANLA
  GRVPWTRVLTDEEAKPFIEMQFIEG
Full Sequence
Protein Sequence     Length: 268     Download
MVAKSHFQVI ILFLLSLLYI TSSYTHTQAD FDKWVSRNVK NYQKRNILEA KLKVAAPDRV    60
SQDGTGDFKT ITEALNSIPP RNTRRVIVSI APGVYREKVM IPKTLPFITL LGDAGDPPTI    120
TGNDTASVSG RTFQSATVQN CYLNSTTRKV ASITAQKRTN SSLESGFSFK NCTVIGSGQV    180
YLGRAWGDYS RVVFSYTFMD NIVLAKGWSD WGDQKRDSRV YYGEYKCSGP GANLAGRVPW    240
TRVLTDEEAK PFIEMQFIEG DTWLISP*                                       300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02432PLN024322.0e-165913880+
PLN02682PLN026821.0e-1930138117+
PLN02665PLN026651.0e-47142267132+
PLN02432PLN024328.0e-48135264130+
PLN02682PLN026821.0e-62139264126+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN79461.10139267253381hypothetical protein [Vitis vinifera]
RefSeqNP_179755.105926452332pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002310842.10.0000000043013712126predicted protein [Populus trichocarpa]
RefSeqXP_002310842.10139266211338predicted protein [Populus trichocarpa]
RefSeqXP_002320279.10129264156287predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A4e-17153266181306B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1xg2_A0.0000000960138785B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A0.0000000000005153264185308A Chain A, Pectin Methylesterase From Carrot
PDB1gq8_A0.0000000005601381189A Chain A, Pectin Methylesterase From Carrot
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG9774851371292650
AM7876081301392680
GD1350221291392670
GD1248621291392670
DW5072521291422680
Orthologous Group
SpeciesID
Arabidopsis lyrata870009.219.302870009.219.302
Brassica rapaBra015416.190.273Bra015416.190.273Bra021217
Carica papayaevm.model.supercontig_26.307.120.240evm.model.supercontig_26.307.120.240evm.model.supercontig_3.29
Capsella rubellaCarubv10022232mCarubv10012537mCarubv10015938m
Citrus sinensisorange1.1g039106m.201.336orange1.1g039106m.201.336
Cucumis sativusCucsa.090570.1.128.230Cucsa.090570.1.128.230
Eucalyptus grandisEucgr.K02430.1
Glycine maxGlyma10g01355.1.136.260Glyma02g09535.1.161.286Glyma02g09535.1.161.286Glyma02g01310.2Glyma10g01355.1.136.260
Gossypium raimondiiGorai.009G272800.1.123.221Gorai.009G272800.1.123.221
Linum usitatissimumLus10036006
Malus domesticaMDP0000753730MDP0000935763MDP0000206418MDP0000161415
Medicago truncatulaMedtr7g102570.1
Mimulus guttatusmgv1a018901mmgv1a025103m.137.229mgv1a025103m.137.229
Oryza sativaLOC_Os02g46310.1
Panicum virgatumPavirv00020445m.249.342Pavirv00017728mPavirv00020445m.249.342Pavirv00029452m
Physcomitrella patensPp1s446_3V6.1.278.400Pp1s446_3V6.1.278.400
Picea abiesMA_10428207g0020MA_7274893g0010MA_10431784g0010
Populus trichocarpaPotri.011G042200.1
Ricinus communis30076.m004630
Vitis viniferaGSVIVT01001104001.139.220GSVIVT01001104001.139.220
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny